• Gene id: 339883

Gene Summary

• Gene Symbol: C3orf35   Gene   UCSC   Ensembl
• Aliases: APRG1
• Gene name: chromosome 3 open reading frame 35
• Alternate names: AP20 region protein 1, AP20 region protein1, APRG1 tumor suppressor candidate,
• Gene location: 3p22.2 (37379110: 37435496)     Exons: 13     NC_000003.12
• OMIM: 611429

Protein Summary

• Protein general information: Q8IVJ8  
  • Name: AP20 region protein 1
  • Length: 170  
  • Mass: 18525
  • Tissue specificity: Isoform 1 is expressed at high levels in the pancreas and placenta. Isoform 2 is expressed at high levels in the kidney. {ECO
• Sequence:

  MKTMATRKRCKLSRTGPEFENVIKRLLCARTFHTRIGGDLTHGIINRGRRANAEQMGLQGSAQHFNIFPLDLWTQ
  GKKTEVQKREGTDSIPAAGRSGTANQPSIAPHRCLFSRGITALDGLKRGRGCNGAAHLVRGDAWKTKLGEPWVSI
  ALALAGPGAILILELSWFLG

• Structural information:
  • STRING: ENSP00000413537
• Other Databases: GeneCards:  C3orf35  Malacards:  C3orf35

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881