• Gene id: 339123

Gene Summary

• Gene Symbol: JMJD8   Gene   UCSC   Ensembl
• Aliases: C16orf20, PP14397
• Gene name: jumonji domain containing 8
• Alternate names: jmjC domain-containing protein 8, jumonji domain-containing protein 8,
• Gene location: 16p13.3 (684333: 681669)     Exons: 8     NC_000016.10
• OMIM: 616997

Protein Summary

• Protein general information: Q96S16  
  • Name: JmjC domain containing protein 8 (Jumonji domain containing protein 8)
  • Length: 264  
  • Mass: 29509
• Sequence:

  MAPASRLLALWALAAVALPGSGAEGDGGWRPGGPGAVAEEERCTVERRADLTYAEFVQQYAFVRPVILQGLTDNS
  RFRALCSRDRLLASFGDRVVRLSTANTYSYHKVDLPFQEYVEQLLHPQDPTSLGNDTLYFFGDNNFTEWASLFRH
  YSPPPFGLLGTAPAYSFGIAGAGSGVPFHWHGPGYSEVIYGRKRWFLYPPEKTPEFHPNKTTLAWLRDTYPALPP
  SARPLECTIRAGEVLYFPDRWWHATLNLDTSVFISTFLG

• Structural information:
  • Protein Domains: (131..26-)
    (/note="JmjC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00538"-)
  • Interpro: IPR041667  IPR003347  
  • Prosite: PS51184
  • STRING: ENSP00000399475
• Other Databases: GeneCards:  JMJD8  Malacards:  JMJD8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005788	endoplasmic reticulum lumen	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0006110	regulation of glycolytic process	IMP	biological process
GO:1903302	regulation of pyruvate kinase activity	IMP	biological process
GO:1903672	positive regulation of sprouting angiogenesis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq