|
Gene id |
338811 |
| Gene Summary Protein Summary Gene ontology Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
TAFA2 Gene UCSC Ensembl |
|
Aliases |
FAM19A2, TAFA-2 |
|
Gene name |
TAFA chemokine like family member 2 |
|
Alternate names |
chemokine-like protein TAFA-2, family with sequence similarity 19 (chemokine (C-C motif)-like), member A2, family with sequence similarity 19 member A2, C-C motif chemokine like, protein FAM19A2, |
|
Gene location |
12q14.1 (62260103: 61708247) Exons: 12 NC_000012.12
|
|
Gene summary(Entrez) |
This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the
|
|
OMIM |
600831 |
Protein Summary
|
| Protein general information
| Q8N3H0
Name: Chemokine like protein TAFA 2
Length: 131 Mass: 14620
Tissue specificity: Brain-specific. {ECO
|
| Sequence |
MSKRYLQKATKGKLLIIIFIVTLWGKVVSSANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVA GTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH
|
| Structural information |
|
| Other Databases |
GeneCards: TAFA2  Malacards: TAFA2 |
|
|
|
|
| Associated diseases |
References |
| Aberrant CpGs in Low Motility Sperm | MIK: 21674046 |
| Cryptorchidism | MIK: 28606200 |
| Unexplained infertility | MIK: 25753583 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 21674046 |
Aberrant C pGs in Low Motility Sperm
|
|
|
18
|
Male infertility |
GSE26881
|
Show abstract |
| 28606200 |
Cryptorchi dism
|
|
|
Monozgotic twin s (1 control, I cwith cryptorc hidism)
|
Male infertility |
MeDIP-Seq
|
Show abstract |
| 25753583 |
Unexplaine d infertil ity
|
|
|
46 (17 fertile men, 29 male pa tients)
|
Male infertility |
Microarray
|
Show abstract |
|