• Gene id: 338657

Gene Summary

• Gene Symbol: CCDC84   Gene   UCSC   Ensembl
• Aliases: DLNB14
• Gene name: coiled-coil domain containing 84
• Alternate names: coiled-coil domain-containing protein 84,
• Gene location: 11q23.3 (118998116: 119015792)     Exons: 12     NC_000011.10
• Gene summary(Entrez): This gene encodes a protein thought to contain a coiled coil motif. No function has been determined for the encoded protein. A pseudogene of this gene is located on chromosome 20. Alternate splicing results in multiple transcript variants. [provided by Re
• OMIM: 0

Protein Summary

• Protein general information: Q86UT8  
  • Name: Coiled coil domain containing protein 84
  • Length: 332  
  • Mass: 37974
• Sequence:

  MAPAQRCPLCRQTFFCGRGHVYSRKHQRQLKEALERLLPQVEAARKAIRAAQVERYVPEHERCCWCLCCGCEVRE
  HLSHGNLTVLYGGLLEHLASPEHKKATNKFWWENKAEVQMKEKFLVTPQDYARFKKSMVKGLDSYEEKEDKVIKE
  MAAQIREVEQSRQEVVRSVLEPQAVPDPEEGSSAPRSWKGMNSQVASSLQQPSNLDLPPAPELDWMETGPSLTFI
  GHQDIPGVGNIHSGATPPWMIQDEEYIAGNQEIGPSYEEFLKEKEKQKLKKLPPDRVGANFDHSSRTSAGWLPSF
  GRVWNNGRRWQSRHQFKTEAAAMKKQSHTEKS

• Structural information:
  • Interpro: IPR028015  
  • STRING: ENSP00000334767
• Other Databases: GeneCards:  CCDC84  Malacards:  CCDC84

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray