• Gene id: 338398

Gene Summary

• Gene Symbol: TAS2R60   Gene   UCSC   Ensembl
• Aliases: T2R56, T2R60
• Gene name: taste 2 receptor member 60
• Alternate names: taste receptor type 2 member 60, taste receptor type 2 member 56, taste receptor, type 2, member 60,
• Gene location: 7q35 (143443452: 143444408)     Exons: 1     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the bitter taste receptor family which belong to the G protein-coupled receptor superfamily and are predominantly expressed in taste receptor cells of the tongue and palate epithelia. This intronless taste receptor gene encod
• OMIM: 613968

Protein Summary

• Protein general information: P59551  
  • Name: Taste receptor type 2 member 60 (T2R60) (Taste receptor type 2 member 56) (T2R56)
  • Length: 318  
  • Mass: 36337
  • Tissue specificity: Expressed in subsets of taste receptor cells of the tongue and exclusively in gustducin-positive cells.
• Sequence:

  MNGDHMVLGSSVTDKKAIILVTILLLLRLVAIAGNGFITAALGVEWVLRRMLLPCDKLLVSLGASRFCLQSVVMG
  KTIYVFLHPMAFPYNPVLQFLAFQWDFLNAATLWSSTWLSVFYCVKIATFTHPVFFWLKHKLSGWLPWMLFSSVG
  LSSFTTILFFIGNHRMYQNYLRNHLQPWNVTGDSIRSYCEKFYLFPLKMITWTMPTAVFFICMILLITSLGRHRK
  KALLTTSGFREPSVQAHIKALLALLSFAMLFISYFLSLVFSAAGIFPPLDFKFWVWESVIYLCAAVHPIILLFSN
  CRLRAVLKSRRSSRCGTP

• Structural information:
  • Interpro: IPR007960  
  • STRING: ENSP00000327724
• Other Databases: GeneCards:  TAS2R60  Malacards:  TAS2R60

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IBA	cellular component
GO:0050909	sensory perception of taste	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050909	sensory perception of taste	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0050896	response to stimulus	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IEA	biological process
GO:0033038	bitter taste receptor activity	IDA	NOT|molecular function
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IDA	NOT|biological process
GO:0016021	integral component of membrane	IDA	cellular component
GO:0050913	sensory perception of bitter taste	NAS	biological process
GO:0004930	G protein-coupled receptor activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04742	Taste transduction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881