• Gene id: 3361

Gene Summary

• Gene Symbol: HTR5A   Gene   UCSC   Ensembl
• Aliases: 5-HT5A
• Gene name: 5-hydroxytryptamine receptor 5A
• Alternate names: 5-hydroxytryptamine receptor 5A, 5-HT-5, 5-HT-5A, 5-hydroxytryptamine (serotonin) receptor 5A, G protein-coupled,
• Gene location: 7q36.2 (155070323: 155087391)     Exons: 2     NC_000007.14
• Gene summary(Entrez): The neurotransmitter serotonin (5-hydroxytryptamine, 5-HT) has been implicated in a wide range of psychiatric conditions and also has vasoconstrictive and vasodilatory effects. The gene described in this record is a member of 5-hydroxytryptamine (serotoni

Protein Summary

• Protein general information: P47898  
  • Name: 5 hydroxytryptamine receptor 5A (5 HT 5) (5 HT 5A) (5 HT5A) (Serotonin receptor 5A)
  • Length: 357  
  • Mass: 40255
• Sequence:

  MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLLVLATILRVRTFHRVP
  HNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRYWSITRHMEYT
  LRTRKCVSNVMIALTWALSAVISLAPLLFGWGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYK
  AAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIP
  FFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH

• Structural information:
  • Interpro: IPR001397  IPR002231  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000287907
• Other Databases: GeneCards:  HTR5A  Malacards:  HTR5A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051378	serotonin binding	IBA	molecular function
GO:0030425	dendrite	IBA	cellular component
GO:0007268	chemical synaptic transmission	IBA	biological process
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA	biological process
GO:0004993	G protein-coupled serotonin receptor activity	IBA	molecular function
GO:0030594	neurotransmitter receptor activity	IBA	molecular function
GO:0007198	adenylate cyclase-inhibiting serotonin receptor signaling pathway	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0004993	G protein-coupled serotonin receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004993	G protein-coupled serotonin receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0004993	G protein-coupled serotonin receptor activity	IDA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0019933	cAMP-mediated signaling	IEA	biological process
GO:0004993	G protein-coupled serotonin receptor activity	IEA	molecular function
GO:0005791	rough endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IEA	biological process
GO:0021766	hippocampus development	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0032355	response to estradiol	IEA	biological process
GO:0007420	brain development	IEA	biological process
GO:0043204	perikaryon	IEA	cellular component
GO:0099060	integral component of postsynaptic specialization membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04020	Calcium signaling pathway
hsa04726	Serotonergic synapse

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray