• Gene id: 3306

Gene Summary

• Gene Symbol: HSPA2   Gene   UCSC   Ensembl
• Aliases: HSP70-2, HSP70-3
• Gene name: heat shock protein family A (Hsp70) member 2
• Alternate names: heat shock-related 70 kDa protein 2, heat shock 70kD protein 2, heat shock 70kDa protein 2,
• Gene location: 14q23.3 (64540467: 64543236)     Exons: 1     NC_000014.9
• OMIM: 140560

Protein Summary

• Protein general information: P54652  
  • Name: Heat shock related 70 kDa protein 2 (Heat shock 70 kDa protein 2)
  • Length: 639  
  • Mass: 70,021
• Sequence:

  MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLI
  GRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISSMVLTKMKEIAEAYLGGKVHSAVITVPAY
  FNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKST
  AGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSI
  TRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYG
  AAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGER
  AMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEA
  ERYKSEDEANRDRVAAKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQK
  ELERVCNPIISKLYQGGPGGGSGGGGSGASGGPTIEEVD

• Structural information:
  • Interpro: IPR018181  IPR029048  IPR029047  IPR013126  
  • Prosite: PS00297 PS00329 PS01036
  • PDB: 3I33 4FSV 5FPD 5FPE 5FPM 5FPN
  • PDBsum: 3I33 4FSV 5FPD 5FPE 5FPM 5FPN
  • STRING: ENSP00000247207
• Other Databases: GeneCards:  HSPA2  Malacards:  HSPA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000795	synaptonemal complex	IEA	cellular component
GO:0001673	male germ cell nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006986	response to unfolded protein	TAS	biological process
GO:0007140	male meiosis	TAS	biological process
GO:0007141	male meiosis I	IEA	biological process
GO:0007283	spermatogenesis	ISS	biological process
GO:0007286	spermatid development	IEA	biological process
GO:0009408	response to heat	ISS	biological process
GO:0009409	response to cold	ISS	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0019899	enzyme binding	IPI	molecular function
GO:0031662	positive regulation of cyclin-dependent protein serine/threonine kinase activity involved in G2/M transition of mitotic cell cycle	IEA	biological process
GO:0036128	CatSper complex	ISS	cellular component
GO:0042026	protein refolding	IDA	biological process
GO:0043209	myelin sheath	IEA	cellular component
GO:0051082	unfolded protein binding	IDA	molecular function
GO:0051861	glycolipid binding	IEA	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070194	synaptonemal complex disassembly	IEA	biological process
GO:0072562	blood microparticle	IDA	cellular component
GO:0072687	meiotic spindle	ISS	cellular component
GO:0090084	negative regulation of inclusion body assembly	IDA	biological process
GO:1901896	positive regulation of calcium-transporting ATPase activity	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000795	synaptonemal complex	IEA	cellular component
GO:0001673	male germ cell nucleus	IEA	cellular component
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0006986	response to unfolded protein	TAS	biological process
GO:0007140	male meiosis	IEA	biological process
GO:0007140	male meiosis	TAS	biological process
GO:0007141	male meiosis I	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007283	spermatogenesis	ISS	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007286	spermatid development	IEA	biological process
GO:0007286	spermatid development	TAS	biological process
GO:0009408	response to heat	ISS	biological process
GO:0009409	response to cold	ISS	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0019899	enzyme binding	IPI	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0031662	positive regulation of cyclin-dependent protein serine/threonine kinase activity involved in G2/M transition of mitotic cell cycle	IEA	biological process
GO:0032781	positive regulation of ATPase activity	IEA	biological process
GO:0036128	CatSper complex	IEA	cellular component
GO:0036128	CatSper complex	ISS	cellular component
GO:0042026	protein refolding	IDA	biological process
GO:0043209	myelin sheath	IEA	cellular component
GO:0051082	unfolded protein binding	IDA	molecular function
GO:0051082	unfolded protein binding	TAS	molecular function
GO:0051861	glycolipid binding	IEA	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070194	synaptonemal complex disassembly	IEA	biological process
GO:0072562	blood microparticle	IDA	cellular component
GO:0072687	meiotic spindle	IEA	cellular component
GO:0072687	meiotic spindle	ISS	cellular component
GO:0090084	negative regulation of inclusion body assembly	IDA	biological process
GO:1901896	positive regulation of calcium-transporting ATPase activity	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006986	response to unfolded protein	TAS	biological process
GO:0007140	male meiosis	TAS	biological process
GO:0007283	spermatogenesis	ISS	biological process
GO:0007286	spermatid development	TAS	biological process
GO:0009408	response to heat	ISS	biological process
GO:0009409	response to cold	ISS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0019899	enzyme binding	IPI	molecular function
GO:0036128	CatSper complex	ISS	cellular component
GO:0042026	protein refolding	IDA	biological process
GO:0051082	unfolded protein binding	IDA	molecular function
GO:0051082	unfolded protein binding	TAS	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0072562	blood microparticle	IDA	cellular component
GO:0072687	meiotic spindle	ISS	cellular component
GO:0090084	negative regulation of inclusion body assembly	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa04612	Antigen processing and presentation
hsa04915	Estrogen signaling pathway
hsa04213	Longevity regulating pathway - multiple species
hsa05134	Legionellosis
hsa05162	Measles
hsa05145	Toxoplasmosis

Diseases

Associated diseases	References
Systemic lupus erythematosus (SLE)	GAD: 11196683
Crohn's disease	GAD: 12730033
Bone diseases	GAD: 11040178
Bone diseases	GAD: 11040178
Alzheimer's disease	GAD: 12782964
Abnormal spermatogenesis	MIK: 10856471
Asthenozoospermia	MIK: 25825237
Male factor infertility	MIK: 26153132
Male factor infertility	MIK: 25825237
Impaired human spermatogenesis	MIK: 20075417
Varicocele	MIK: 16140088
Spermatocyte arrest	MIK: 10856471
Sertoli cell only syndrome (SCOS)	MIK: 10856471
Varicocele	MIK: 17007855
Male factor infertility	MIK: 16517558
Oligozoospermia	MIK: 16517558
Azoospermia	MIK: 25439847
Capacitation	MIK: 22670834
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Asthenozoospermia	MIK: 25825237
Male infertility	MIK: 27209630
Azoospermia	MIK: 25439847
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 20075417
Capacitation	MIK: 22670834
Varicocele	MIK: 16140088
May play a specific role during meiosis in human testes	MIK: 10587366
Oligozoospermia	MIK: 16517558
Sertoli cell-only syndrome	MIK: 10856471
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17007855	Varicocele				Male infertility
16517558	Oligozoospermia			38 (17 with oligozoospermia, 21 fertile controls)	Male infertility
25825237	Asthenozoospermia				Male infertility	Tubulin beta 2B; glutathione S-transferase Mu 3; keratin type II cytoskeletal 1; outer dense fiber protein 2; voltage-dependent anion-selective channel protein 2; A-kinase anchor protein 4; cytochrome c oxidase subunit 6B; sperm protein associated with t
20075417	Impaired human spermatogenesis			28 (13 patients with spermatogenic failure, 5 patients with primary germ cell tumors, 10 controls with conserved spermatogenesis)	Male infertility	MLH1 MLH3 PMS2 MSH4 and MSH5 ATR HSPA2 and SYCP3
23209833	Male infertility				Male infertility
22670834	Male infertility, Capacitation			96 (49 individuals with male factor infertility, 47 fertile individuals)	Male infertility
17007855	Varicocele				Male infertility
26153132	Male idiopathic infertility				Male infertility	BAG6 HSPA2
10856471	Spermatocyte arrest, Sertoli cell-only syndrome			15 (5 normal spermatogenesis, 5 spermatocyte arrest, 5 Sertoli cell-only syndrome)	Male infertility
16140088	Male infertility, varicocele			81 (56 varicocele, 25 controls)	Male infertility
25439847	Azoospermia			226 (19 with histologically confirmed meiotic arrest, 110 men with azoospermia in the absence of histologic data, 97 fertile men (controls))	Male infertility
10856471	Abnormal spermatogenesis			15 azoospermic patients (5 normal spermatogenesis, 5 patients with spermatocyte arrest, 5 patients with Sertoli cell- only syndrome)	Male infertility	hspA2
10587366	May play a specific role during meiosis in human testes				Male infertility
27209630	Asthenozoospermia, Male infertility			37 (21 asthenozoospermic patients, 16 normozoospermic individuals)	Male infertility
25308252	Involved in spermatogenic impairment, Male infertility				Male infertility
21737689	Involvement during spermatogenesis				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R