• Gene id: 3299

Gene Summary

• Gene Symbol: HSF4   Gene   UCSC   Ensembl
• Aliases: CTM, CTRCT5
• Gene name: heat shock transcription factor 4
• Alternate names: heat shock factor protein 4, HSF 4, HSTF 4, hHSF4,
• Gene location: 16q22.1 (67163760: 67169940)     Exons: 15     NC_000016.10
• Gene summary(Entrez): Heat-shock transcription factors (HSFs) activate heat-shock response genes under conditions of heat or other stresses. HSF4 lacks the carboxyl-terminal hydrophobic repeat which is shared among all vertebrate HSFs and has been suggested to be involved in t
• OMIM: 601557

Protein Summary

• Protein general information: Q9ULV5  
  • Name: Heat shock factor protein 4 (HSF 4) (hHSF4) (Heat shock transcription factor 4) (HSTF 4)
  • Length: 492  
  • Mass: 53011
  • Tissue specificity: Expressed in heart, skeletal muscle, eye and brain, and at much lower levels in some other tissues. {ECO
• Sequence:

  MQEAPAALPTEPGPSPVPAFLGKLWALVGDPGTDHLIRWSPSGTSFLVSDQSRFAKEVLPQYFKHSNMASFVRQL
  NMYGFRKVVSIEQGGLLRPERDHVEFQHPSFVRGREQLLERVRRKVPALRGDDGRWRPEDLGRLLGEVQALRGVQ
  ESTEARLRELRQQNEILWREVVTLRQSHGQQHRVIGKLIQCLFGPLQAGPSNAGGKRKLSLMLDEGSSCPTPAKF
  NTCPLPGALLQDPYFIQSPLPETNLGLSPHRARGPIISDIPEDSPSPEGTRLSPSSDGRREKGLALLKEEPASPG
  GDGEAGLALAPNECDFCVTAPPPLPVAVVQAILEGKGSFSPEGPRNAQQPEPGDPREIPDRGPLGLESGDRSPES
  LLPPMLLQPPQESVEPAGPLDVLGPSLQGREWTLMDLDMELSLMQPLVPERGEPELAVKGLNSPSPGKDPTLGAP
  LLLDVQAALGGPALGLPGALTIYSTPESRTASYLGPEASPSP

• Structural information:
  • Interpro: IPR000232  IPR027725  IPR036388  IPR036390  
  • Prosite: PS00434
  • PDB: 6J6V 6J6W
  • PDBsum: 6J6V 6J6W
  • STRING: ENSP00000264009
• Other Databases: GeneCards:  HSF4  Malacards:  HSF4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	molecular function
GO:0000790	nuclear chromatin	IDA	is active in
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0043618	regulation of transcription from RNA polymerase II promoter in response to stress	IBA	biological process
GO:0043565	sequence-specific DNA binding	IBA	molecular function
GO:0034605	cellular response to heat	IBA	biological process
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0061408	positive regulation of transcription from RNA polymerase II promoter in response to heat stress	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0042025	host cell nucleus	IEA	cellular component
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0007601	visual perception	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0033169	histone H3-K9 demethylation	IEA	biological process
GO:0043010	camera-type eye development	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0045597	positive regulation of cell differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0001654	eye development	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0048468	cell development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component

Diseases

Associated diseases	References
Cataract	KEGG:H01202
Cataract	KEGG:H01202
Cataract	PMID:12089525
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq