• Gene id: 326340

Gene Summary

• Gene Symbol: ZAR1   Gene   UCSC   Ensembl
• Aliases: Z3CXXC6
• Gene name: zygote arrest 1
• Alternate names: zygote arrest protein 1, oocyte-specific maternal effect factor, zinc finger, 3CxxC-type 6,
• Gene location: 4p11 (48490251: 48499350)     Exons: 5     NC_000004.12
• Gene summary(Entrez): This maternal effect gene is oocyte-specific and encodes a protein that is thought to function in the initiation of embryogenesis. A similar protein in mouse is required for female fertility. [provided by RefSeq, Jul 2013]
• OMIM: 607520

Protein Summary

• Protein general information: Q86SH2  
  • Name: Zygote arrest protein 1 (Oocyte specific maternal effect factor)
  • Length: 424  
  • Mass: 45873
  • Tissue specificity: Ovary and testis. {ECO
• Sequence:

  MAALGDEVLDGYVFPACPPCSYRYPYPAATKGKGAAGGSWQQRGRGCLPASSPCSAGAASLSFPGCGRLTAAEYF
  DSYQRERLMALLAQVGPGLGPRARRAGSCDVAVQVSPRIDAAVQCSLGRRTLQRRARDPESPAGPGAEGTTGGGS
  FSQQPSRRGLEQGSPQNGAPRPMRFPRTVAVYSPLALRRLTAFLEGPGPAAGEQRSGASDGERGPPPARLQGPEE
  GEVWTKKAPRRPQSDDDGEAQAAVRASWEQPADGPELPPREAQEGEAAPRSALRSPGQPPSAGRARDGGDGREAA
  VAGEGPSPRSPELGKERLRFQFLEQKYGYYHCKDCNIRWESAYVWCVQGTNKVYFKQFCRTCQKSYNPYRVEDIT
  CQSCKQTRCSCPVKLRHVDPKRPHRQDLCGRCKGKRLSCDSTFSFKYII

• Structural information:
  • Interpro: IPR026775  IPR027377  
  • STRING: ENSP00000329803
• Other Databases: GeneCards:  ZAR1  Malacards:  ZAR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007275	multicellular organism development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)