• Gene id: 3218

Gene Summary

• Gene Symbol: HOXB8   Gene   UCSC   Ensembl
• Aliases: HOX2, HOX2D, Hox-2.4
• Gene name: homeobox B8
• Alternate names: homeobox protein Hox-B8, homeo box 2D, homeo box B8, homeobox protein Hox-2.4, homeobox protein Hox-2D,
• Gene location: 17q21.32 (48619530: 48612345)     Exons: 5     NC_000017.11
• Gene summary(Entrez): This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcriptio

Protein Summary

• Protein general information: P17481  
  • Name: Homeobox protein Hox B8 (Homeobox protein Hox 2.4) (Homeobox protein Hox 2D)
  • Length: 243  
  • Mass: 27574
• Sequence:

  MSSYFVNSLFSKYKTGESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHGPSSLSTAPYQQNPCA
  VACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGEEAEGSEQSPSPTQLFPWMRPQAAAGRRRGR
  QTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKQKL
  ERAPEAADEGDAQKGDKK

• Structural information:
  • Interpro: IPR009057  IPR001827  IPR017970  IPR001356  IPR020479   IPR000047  
  • Prosite: PS00032 PS00027 PS50071
  • CDD: cd00086
  • STRING: ENSP00000239144
• Other Databases: GeneCards:  HOXB8  Malacards:  HOXB8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0045638	negative regulation of myeloid cell differentiation	ISS	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0048705	skeletal system morphogenesis	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0021516	dorsal spinal cord development	IEA	biological process
GO:0009952	anterior/posterior pattern specification	IEA	biological process
GO:0008344	adult locomotory behavior	IEA	biological process
GO:0048704	embryonic skeletal system morphogenesis	IEA	biological process
GO:0045638	negative regulation of myeloid cell differentiation	IEA	biological process
GO:0019233	sensory perception of pain	IEA	biological process
GO:0007625	grooming behavior	IEA	biological process
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881