Male Infertility Database

Search Result

Gene id

317762

Gene Summary Protein Summary Gene ontology Diseases PubMed

Gene Summary

Gene Symbol

CCDC85C Gene UCSC Ensembl

Gene name

coiled-coil domain containing 85C

Alternate names

coiled-coil domain-containing protein 85C,

Gene location

14q32.2 (99604206: 99500189) Exons: 8 NC_000014.9

Protein Summary

Protein general information

A6NKD9

Name: Coiled coil domain containing protein 85C

Length: 419 Mass: 45210

Sequence

MAKPAATAAAASEELSQVPDEELLRWSKEELARRLRRAEGEKVGLMLEHGGLMRDVNRRLQQHLLEIRGLKDVNQ
RLQDDNQELRELCCFLDDDRQKGRKLAREWQRFGRHAAGAVWHEVARSQQKLRELEARQEALLRENLELKELVLL
LDEERAALAATGAASGGGGGGGGAGSRSSIDSQASLSGPLSGGAPGAGARDVGDGSSTSSAGSGGSPDHHHHVPP
PLLPPGPHKAPDGKAGATRRSLDDLSAPPHHRSIPNGLHDPSSTYIRQLESKVRLLEGDKLLAQQAGSGEFRTLR
KGFSPYHSESQLASLPPSYQDSLQNGPACPAPELPSPPSAGYSPAGQKPEAVVHAMKVLEVHENLDRQLQDSCEE
DLSEKEKAIVREMCNVVWRKLGDAASSKPSIRQHLSGNQFKGPL

Structural information

Interpro:	IPR019359
DIP:	56878
STRING:	ENSP00000369592

Other Databases

GeneCards: CCDC85C Malacards: CCDC85C

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0043296	apical junction complex	ISS	cellular component
GO:0021987	cerebral cortex developme nt	ISS	biological process
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0007275	multicellular organism de velopment	IEA	biological process
GO:0043296	apical junction complex	IEA	cellular component
GO:0021987	cerebral cortex developme nt	IEA	biological process
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005912	adherens junction	IEA	cellular component

Diseases

Expand All | Collapse All

Associated diseases	References
Cryptorchidism	MIK: 28606200
Male factor infertility	MIK: 29961538

PubMed references

Expand All | Collapse All

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
29961538	Male facto r infertil ity			318 (128 couple s presenting wi th OAT (MF) and 118 maternal a ge-matched cont rol (no MF) sub jects undergoin g infertility t reatment, 72 su rplus cryoprese rved blastocyst s)	Male infertility	RNA-seq	Show abstract
28606200	Cryptorchi dism			Monozgotic twin s (1 control, I cwith cryptorc hidism)	Male infertility	MeDIP-Seq	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Diseases

Expand All | Collapse All