• Gene id: 317702

Gene Summary

• Gene Symbol: VN1R3   Gene   UCSC   Ensembl
• Aliases: FKSG46, V1RL3, V1RL3p
• Gene name: vomeronasal 1 receptor 3
• Alternate names: vomeronasal type-1 receptor 3, V1R-like 3, V1RL3 pseudogene, V1r-like receptor 3, vomeronasal 1 receptor 3 pseudogene, vomeronasal 1 receptor 4 pseudogene,
• Gene location: 16p11.2 (31808852: 31807584)     Exons: 7     NC_000016.10

Protein Summary

• Protein general information: Q9BXE9  
  • Name: Vomeronasal type 1 receptor 3 (V1r like receptor 3)
  • Length: 311  
  • Mass: 34713
• Sequence:

  MASKDFAIGMILLSQIMVGFLGNFFLLYHYSFLCFTRGMLQSTDLILKHLTIANSLVILSKGIPQTMAAFGLKDS
  LSDIGCKFVFYVHRVGRAVCVGNACLLSVFQVITISPSEFRWAELKLHAHKYIRSFILVLCWILNTLVNITVLLH
  VTGKWNSINSTKTNDYGYCSGGSRSRIPHSLHIVLLSSLDVLCLGLMTLASGSMVFILHRHKQQVQHIHGTNLSA
  RSSPESRVTQSILVLVSTLCYFTRSPPSLHMSLFPNPSWWLLNTSALITACFPMVSPFVLMSRHPRIPRLGSACC
  GRNPQFPKLVR

• Structural information:
  • Interpro: IPR017452  IPR004072  
  • Prosite: PS50262
  • CDD: cd13949
• Other Databases: GeneCards:  VN1R3  Malacards:  VN1R3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016503	pheromone receptor activity	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0019236	response to pheromone	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)