• Gene id: 3175

Gene Summary

• Gene Symbol: ONECUT1   Gene   UCSC   Ensembl
• Aliases: HNF-6, HNF6, HNF6A
• Gene name: one cut homeobox 1
• Alternate names: hepatocyte nuclear factor 6, hepatocyte nuclear factor 6, alpha, one cut domain family member 1,
• Gene location: 15q21.3 (52790335: 52755052)     Exons: 6     NC_000015.10
• Gene summary(Entrez): This gene encodes a member of the Cut homeobox family of transcription factors. Expression of the encoded protein is enriched in the liver, where it stimulates transcription of liver-expressed genes, and antagonizes glucocorticoid-stimulated gene transcri
• OMIM: 606057

Protein Summary

• Protein general information: Q9UBC0  
  • Name: Hepatocyte nuclear factor 6 (HNF 6) (One cut domain family member 1) (One cut homeobox 1)
  • Length: 465  
  • Mass: 51023
  • Tissue specificity: Highly expressed in liver; lower expression in testis and skin.
• Sequence:

  MNAQLTMEAIGELHGVSHEPVPAPADLLGGSPHARSSVAHRGSHLPPAHPRSMGMASLLDGGSGGGDYHHHHRAP
  EHSLAGPLHPTMTMACETPPGMSMPTTYTTLTPLQPLPPISTVSDKFPHHHHHHHHHHHPHHHQRLAGNVSGSFT
  LMRDERGLASMNNLYTPYHKDVAGMGQSLSPLSSSGLGSIHNSQQGLPHYAHPGAAMPTDKMLTPNGFEAHHPAM
  LGRHGEQHLTPTSAGMVPINGLPPHHPHAHLNAQGHGQLLGTAREPNPSVTGAQVSNGSNSGQMEEINTKEVAQR
  ITTELKRYSIPQAIFAQRVLCRSQGTLSDLLRNPKPWSKLKSGRETFRRMWKWLQEPEFQRMSALRLAACKRKEQ
  EHGKDRGNTPKKPRLVFTDVQRRTLHAIFKENKRPSKELQITISQQLGLELSTVSNFFMNARRRSLDKWQDEGSS
  NSGNSSSSSSTCTKA

• Structural information:
  • Interpro: IPR003350  IPR009057  IPR001356  IPR010982  
  • Prosite: PS51042 PS50071
  • CDD: cd00086
  • STRING: ENSP00000302630
• Other Databases: GeneCards:  ONECUT1  Malacards:  ONECUT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0030154	cell differentiation	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003677	DNA binding	IBA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006006	glucose metabolic process	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0007492	endoderm development	IEA	biological process
GO:0009653	anatomical structure morphogenesis	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0030183	B cell differentiation	IEA	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0045165	cell fate commitment	IEA	biological process
GO:0060271	cilium assembly	IEA	biological process
GO:0001889	liver development	IEA	biological process
GO:0001952	regulation of cell-matrix adhesion	IEA	biological process
GO:0002064	epithelial cell development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	IEA	biological process
GO:0031016	pancreas development	IEA	biological process
GO:0031018	endocrine pancreas development	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0048536	spleen development	IEA	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa04950	Maturity onset diabetes of the young

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881