• Gene id: 313

Gene Summary

• Gene Symbol: AOAH   Gene   UCSC   Ensembl
• Gene name: acyloxyacyl hydrolase
• Alternate names: acyloxyacyl hydrolase, acyloxyacyl hydrolase (neutrophil),
• Gene location: 7p14.2 (36724548: 36509312)     Exons: 31     NC_000007.14
• Gene summary(Entrez): This locus encodes both the light and heavy subunits of acyloxyacyl hydrolase. The encoded enzyme catalyzes the hydrolysis of acyloxylacyl-linked fatty acyl chains from bacterial lipopolysaccharides, effectively detoxifying these molecules. The encoded pr
• OMIM: 603751

Protein Summary

• Protein general information: P28039  
  • Name: Acyloxyacyl hydrolase (EC 3.1.1.77) [Cleaved into: Acyloxyacyl hydrolase small subunit; Acyloxyacyl hydrolase large subunit]
  • Length: 575  
  • Mass: 65105
• Sequence:

  MQSPWKILTVAPLFLLLSLQSSASPANDDQSRPSLSNGHTCVGCVLVVSVIEQLAQVHNSTVQASMERLCSYLPE
  KLFLKTTCYLVIDKFGSDIIKLLSADMNADVVCHTLEFCKQNTGQPLCHLYPLPKETWKFTLQKARQIVKKSPIL
  KYSRSGSDICSLPVLAKICQKIKLAMEQSVPFKDVDSDKYSVFPTLRGYHWRGRDCNDSDESVYPGRRPNNWDVH
  QDSNCNGIWGVDPKDGVPYEKKFCEGSQPRGIILLGDSAGAHFHISPEWITASQMSLNSFINLPTALTNELDWPQ
  LSGATGFLDSTVGIKEKSIYLRLWKRNHCNHRDYQNISRNGASSRNLKKFIESLSRNKVLDYPAIVIYAMIGNDV
  CSGKSDPVPAMTTPEKLYSNVMQTLKHLNSHLPNGSHVILYGLPDGTFLWDNLHNRYHPLGQLNKDMTYAQLYSF
  LNCLQVSPCHGWMSSNKTLRTLTSERAEQLSNTLKKIAASEKFTNFNLFYMDFAFHEIIQEWQKRGGQPWQLIEP
  VDGFHPNEVALLLLADHFWKKVQLQWPQILGKENPFNPQIKQVFGDQGGH

• Structural information:
  • Protein Domains: (37..11-)
    (/note="Saposin-B-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00415"-)
  • Interpro: IPR039676  IPR001087  IPR008138  IPR011001  IPR008139  
  • Prosite: PS50015
  • PDB: 5W78 5W7C
  • PDBsum: 5W78 5W7C
  • STRING: ENSP00000479664
• Other Databases: GeneCards:  AOAH  Malacards:  AOAH

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050528	acyloxyacyl hydrolase activity	IBA	molecular function
GO:0009104	lipopolysaccharide catabolic process	IBA	biological process
GO:0005509	calcium ion binding	IBA	molecular function
GO:0050728	negative regulation of inflammatory response	IBA	biological process
GO:0009104	lipopolysaccharide catabolic process	IDA	biological process
GO:0050528	acyloxyacyl hydrolase activity	IDA	molecular function
GO:0050528	acyloxyacyl hydrolase activity	IDA	molecular function
GO:0009104	lipopolysaccharide catabolic process	IDA	biological process
GO:0005509	calcium ion binding	IDA	molecular function
GO:0006631	fatty acid metabolic process	IDA	biological process
GO:0006631	fatty acid metabolic process	IDA	biological process
GO:0016788	hydrolase activity, acting on ester bonds	IEA	molecular function
GO:0050528	acyloxyacyl hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0050528	acyloxyacyl hydrolase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881