Search Result
| Gene id | 312 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary SNPs Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | ANXA13 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | ANX13, ISA | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | annexin A13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | annexin A13, annexin XIII, annexin, intestine-specific, annexin-13, intestine-specific annexin, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
8q24.13 (123737392: 123680793) Exons: 12 NC_000008.11 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The specific function of this gene has not yet be |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 602573 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
SNPs |
rs606231461 Strand: Allele origin: Allele change: Mutation type: delins NC_000015.10 g.51481268_51481282del NC_000015.9 g.51773465_51773479del NG_017155.1 g.146492_146506del NM_015263.3 c.5827_5841del NM_015263.4 c.5827_5841del NM_001174116.1 c.5827_5841del NM_001174116.2 c.5827_5841del NM_001174117.1 c.3919_3933del NM_0 rs3129878 Strand: Allele origin: Allele change: Mutation type: snv NC_000006.12 g.32440958A>C NC_000006.11 g.32408735A>C NT_113891.3 g.3879082C>A NT_113891.2 g.3879188C>A NG_002392.2 g.5293C>A NT_167248.2 g.3664005A>C NT_167248.1 g.3669601A>C NT_167245.2 g.3681261A>C NT_167245.1 g.3686846A>C NT_167249.2 g.3756099A>C rs4680 Strand: Allele origin: Allele change: Mutation type: snv NC_000022.11 g.19963748G>A NC_000022.10 g.19951271G>A NG_011526.1 g.27009G>A NM_000754.4 c.472G>A NM_000754.3 c.472G>A NM_007310.3 c.322G>A NM_007310.2 c.322G>A NM_001362828.2 c.472G>A NM_001362828.1 c.472G>A NM_001135161.2 c.472G>A NM_001135161.1 c. rs7194 Strand: Allele origin: Allele change: Mutation type: snv NC_000006.12 g.32444703G>A NC_000006.12 g.32444703G>C NC_000006.11 g.32412480G>A NC_000006.11 g.32412480G>C NT_113891.3 g.3882792G>A NT_113891.3 g.3882792G>C NT_113891.2 g.3882898G>A NT_113891.2 g.3882898G>C NG_002392.2 g.9003G>A NG_002392.2 g.9003G> rs370681 Strand: Allele origin: Allele change: Mutation type: snv NC_000016.10 g.342461C>T NC_000016.9 g.392461C>T NG_012267.1 g.15004G>A|SEQ=[C/T]|GENE=AXIN1 rs1805105 Strand: Allele origin: Allele change: Mutation type: snv NC_000016.10 g.346264A>G NC_000016.9 g.396264A>G NG_012267.1 g.11201T>C NM_003502.4 c.762T>C NM_003502.3 c.762T>C NM_181050.3 c.762T>C NM_181050.2 c.762T>C NR_134879.2 n.1198T>C NR_134879.1 n.1151T>C XM_011522682.2 c.909T>C XM_011522683.2 c.909T>C XM |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | P27216 Name: Annexin A13 (Annexin XIII) (Annexin 13) (Intestine specific annexin) (ISA) Length: 316 Mass: 35415 Tissue specificity: Detected in epithelial cells in colon and jejunum (at protein level). Detected in epithelial cells in jejunum. {ECO | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MGNRHAKASSPQGFDVDRDAKKLNKACKGMGTNEAAIIEILSGRTSDERQQIKQKYKATYGKELEEVLKSELSGN FEKTALALLDRPSEYAARQLQKAMKGLGTDESVLIEVLCTRTNKEIIAIKEAYQRLFDRSLESDVKGDTSGNLKK ILVSLLQANRNEGDDVDKDLAGQDAKDLYDAGEGRWGTDELAFNEVLAKRSYKQLRATFQAYQILIGKDIEEAIE EETSGDLQKAYLTLVRCAQDCEDYFAERLYKSMKGAGTDEETLIRIVVTRAEVDLQGIKAKFQEKYQKSLSDMVR SDTSGDFRKLLVALLH | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: ANXA13  Malacards: ANXA13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||