• Gene id: 30849

Gene Summary

• Gene Symbol: PIK3R4   Gene   UCSC   Ensembl
• Aliases: VPS15, p150
• Gene name: phosphoinositide-3-kinase regulatory subunit 4
• Alternate names: phosphoinositide 3-kinase regulatory subunit 4, PI3-kinase p150 subunit, PI3-kinase regulatory subunit 4, phosphatidylinositol 3-kinase-associated p150, phosphoinositide 3-kinase adaptor protein, phosphoinositide-3-kinase, regulatory subunit 4, p150,
• Gene location: 3q22.1 (130746828: 130678933)     Exons: 20     NC_000003.12
• OMIM: 602610

Protein Summary

• Protein general information: Q99570  
  • Name: Phosphoinositide 3 kinase regulatory subunit 4 (PI3 kinase regulatory subunit 4) (EC 2.7.11.1) (PI3 kinase p150 subunit) (Phosphoinositide 3 kinase adaptor protein)
  • Length: 1358  
  • Mass: 153103
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MGNQLAGIAPSQILSVESYFSDIHDFEYDKSLGSTRFFKVARAKHREGLVVVKVFAIQDPTLPLTSYKQELEELK
  IRLNSAQNCLPFQKASEKASEKAAMLFRQYVRDNLYDRISTRPFLNNIEKRWIAFQILTAVDQAHKSGVRHGDIK
  TENVMVTSWNWVLLTDFASFKPTYLPEDNPADFNYFFDTSRRRTCYIAPERFVDGGMFATELEYMRDPSTPLVDL
  NSNQRTRGELKRAMDIFSAGCVIAELFTEGVPLFDLSQLLAYRNGHFFPEQVLNKIEDHSIRELVTQMIHREPDK
  RLEAEDYLKQQRGNAFPEIFYTFLQPYMAQFAKETFLSADERILVIRKDLGNIIHNLCGHDLPEKAEGEPKENGL
  VILVSVITSCLQTLKYCDSKLAALELILHLAPRLSVEILLDRITPYLLHFSNDSVPRVRAEALRTLTKVLALVKE
  VPRNDINIYPEYILPGIAHLAQDDATIVRLAYAENIALLAETALRFLELVQLKNLNMENDPNNEEIDEVTHPNGN
  YDTELQALHEMVQQKVVTLLSDPENIVKQTLMENGITRLCVFFGRQKANDVLLSHMITFLNDKNDWHLRGAFFDS
  IVGVAAYVGWQSSSILKPLLQQGLSDAEEFVIVKALYALTCMCQLGLLQKPHVYEFASDIAPFLCHPNLWIRYGA
  VGFITVVARQISTADVYCKLMPYLDPYITQPIIQIERKLVLLSVLKEPVSRSIFDYALRSKDITSLFRHLHMRQK
  KRNGSLPDCPPPEDPAIAQLLKKLLSQGMTEEEEDKLLALKDFMMKSNKAKANIVDQSHLHDSSQKGVIDLAALG
  ITGRQVDLVKTKQEPDDKRARKHVKQDSNVNEEWKSMFGSLDPPNMPQALPKGSDQEVIQTGKPPRSESSAGICV
  PLSTSSQVPEVTTVQNKKPVIPVLSSTILPSTYQIRITTCKTELQQLIQQKREQCNAERIAKQMMENAEWESKPP
  PPGWRPKGLLVAHLHEHKSAVNRIRVSDEHSLFATCSNDGTVKIWNSQKMEGKTTTTRSILTYSRIGGRVKTLTF
  CQGSHYLAIASDNGAVQLLGIEASKLPKSPKIHPLQSRILDQKEDGCVVDMHHFNSGAQSVLAYATVNGSLVGWD
  LRSSSNAWTLKHDLKSGLITSFAVDIHQCWLCIGTSSGTMACWDMRFQLPISSHCHPSRARIRRLSMHPLYQSWV
  IAAVQGNNEVSMWDMETGDRRFTLWASSAPPLSELQPSPHSVHGIYCSPADGNPILLTAGSDMKIRFWDLAYPER
  SYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASR
  DGIVKVWK

• Structural information:
  • Protein Domains: (26..32-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011989  IPR016024  IPR021133  IPR011009  IPR000719   IPR008271  IPR015943  IPR001680  IPR019775  IPR017986  IPR036322  
  • Prosite: PS50077 PS50011 PS00108 PS00678 PS50082 PS50294
  • DIP: 42310
  • STRING: ENSP00000349205
• Other Databases: GeneCards:  PIK3R4  Malacards:  PIK3R4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005770	late endosome	IBA	cellular component
GO:0006468	protein phosphorylation	IBA	biological process
GO:0016236	macroautophagy	IBA	biological process
GO:0030242	autophagy of peroxisome	IBA	biological process
GO:0034271	phosphatidylinositol 3-kinase complex, class III, type I	IBA	cellular component
GO:0071561	nucleus-vacuole junction	IBA	cellular component
GO:0006623	protein targeting to vacuole	IBA	biological process
GO:0034272	phosphatidylinositol 3-kinase complex, class III, type II	IBA	cellular component
GO:0045324	late endosome to vacuole transport	IBA	biological process
GO:0043552	positive regulation of phosphatidylinositol 3-kinase activity	IDA	biological process
GO:0005770	late endosome	IDA	cellular component
GO:0042149	cellular response to glucose starvation	ISS	biological process
GO:0032801	receptor catabolic process	IMP	biological process
GO:0005930	axoneme	ISS	cellular component
GO:0035032	phosphatidylinositol 3-kinase complex, class III	ISS	cellular component
GO:0032465	regulation of cytokinesis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0006661	phosphatidylinositol biosynthetic process	TAS	biological process
GO:0006661	phosphatidylinositol biosynthetic process	TAS	biological process
GO:0006661	phosphatidylinositol biosynthetic process	TAS	biological process
GO:0016236	macroautophagy	TAS	biological process
GO:0030670	phagocytic vesicle membrane	TAS	cellular component
GO:0034162	toll-like receptor 9 signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042149	cellular response to glucose starvation	IEA	biological process
GO:0005930	axoneme	IEA	cellular component
GO:0035032	phosphatidylinositol 3-kinase complex, class III	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005770	late endosome	IEA	cellular component
GO:0005776	autophagosome	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0006468	protein phosphorylation	NAS	biological process
GO:0004672	protein kinase activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa05131	Shigellosis
hsa05017	Spinocerebellar ataxia
hsa04140	Autophagy - animal
hsa04371	Apelin signaling pathway
hsa04136	Autophagy - other

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq