• Gene id: 3061

Gene Summary

• Gene Symbol: HCRTR1   Gene   UCSC   Ensembl
• Aliases: OX1R
• Gene name: hypocretin receptor 1
• Alternate names: orexin receptor type 1, hypocretin (orexin) receptor 1, hypocretin receptor type 1, orexin receptor 1,
• Gene location: 1p35.2 (216423447: 215622890)     Exons: 72     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior. The encoded protein selectively binds the hypothalamic neuropeptide orexin A. A related gene (HCRTR2) encodes a G-protein coupled receptor tha
• OMIM: 602392

Protein Summary

• Protein general information: O43613  
  • Name: Orexin receptor type 1 (Ox 1 R) (Ox1 R) (Ox1R) (Hypocretin receptor type 1)
  • Length: 425  
  • Mass: 47536
• Sequence:

  MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNH
  HMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICH
  PLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYL
  APLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKML
  MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSC
  CLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000204  IPR004059  
  • Prosite: PS00237 PS50262
  • PDB: 4ZJ8 4ZJC 6TO7 6TOD 6TOS 6TOT 6TP3 6TP4 6TP6 6TQ4 6TQ6 6TQ7 6TQ9
  • PDBsum: 4ZJ8 4ZJC 6TO7 6TOD 6TOS 6TOT 6TP3 6TP4 6TP6 6TQ4 6TQ6 6TQ7 6TQ9
  • STRING: ENSP00000384387
• Other Databases: GeneCards:  HCRTR1  Malacards:  HCRTR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007218	neuropeptide signaling pathway	IBA	biological process
GO:0042277	peptide binding	IBA	molecular function
GO:0032870	cellular response to hormone stimulus	IBA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0051480	regulation of cytosolic calcium ion concentration	IDA	biological process
GO:0007218	neuropeptide signaling pathway	IDA	biological process
GO:0016499	orexin receptor activity	IDA	molecular function
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007631	feeding behavior	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016499	orexin receptor activity	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007631	feeding behavior	TAS	biological process
GO:0007218	neuropeptide signaling pathway	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0016499	orexin receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0017046	peptide hormone binding	IEA	molecular function
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R