|
Gene id |
3018 |
| Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
H2BC3 Gene UCSC Ensembl |
|
Aliases |
H2B.1, H2B/f, H2BFF, HIST1H2BB |
|
Gene name |
H2B clustered histone 3 |
|
Alternate names |
histone H2B type 1-B, H2B histone family, member F, histone 1, H2bb, histone H2B.1, histone H2B.f, histone cluster 1 H2B family member b, histone cluster 1, H2bb, |
|
Gene location |
6p22.2 (26043712: 26043226) Exons: 1 NC_000006.12
|
|
Gene summary(Entrez) |
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core hi
|
|
OMIM |
602803 |
Protein Summary
|
| Protein general information
| P33778
Name: Histone H2B type 1 B (H2B clustered histone 3) (Histone H2B.1) (Histone H2B.f) (H2B/f)
Length: 126 Mass: 13950
|
| Sequence |
MPEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIA GEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
|
| Structural information |
|
| Other Databases |
GeneCards: H2BC3  Malacards: H2BC3 |
|
|
|
|
|
|
|
| Associated diseases |
References |
| Teratozoospermia | MIK: 17327269 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 17327269 |
Teratozoos permia
|
|
|
13 (5 controls, 8 cases)
|
Male infertility |
GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
|