• Gene id: 3004

Gene Summary

• Gene Symbol: GZMM   Gene   UCSC   Ensembl
• Aliases: LMET1, MET1
• Gene name: granzyme M
• Alternate names: granzyme M, HU-Met-1, Met-1 serine protease, lymphocyte met-ase 1, met-ase, natural killer cell granular protease,
• Gene location: 19p13.3 (544052: 549921)     Exons: 5     NC_000019.10
• Gene summary(Entrez): Human natural killer (NK) cells and activated lymphocytes express and store a distinct subset of neutral serine proteases together with proteoglycans and other immune effector molecules in large cytoplasmic granules. These serine proteases are collectivel
• OMIM: 601463

Protein Summary

• Protein general information: P51124  
  • Name: Granzyme M (EC 3.4.21. ) (Met 1 serine protease) (Hu Met 1) (Met ase) (Natural killer cell granular protease)
  • Length: 257  
  • Mass: 27545
  • Tissue specificity: Highly and constitutively expressed in activated natural killer (NK) cells. {ECO
• Sequence:

  MEACVSSLLVLALGALSVGSSFGTQIIGGREVIPHSRPYMASLQRNGSHLCGGVLVHPKWVLTAAHCLAQRMAQL
  RLVLGLHTLDSPGLTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQVVAAGTRCSMAGW
  GLTHQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCLAADSKDQAPCKGDSGGPLVCGKGRVLARVLSF
  SSRVCTDIFKPPVATAVAPYVSWIRKVTGRSA

• Structural information:
  • Protein Domains: (26..25-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00274"-)
  • Interpro: IPR033040  IPR009003  IPR001314  IPR001254  IPR018114   IPR033116  
  • Prosite: PS50240 PS00134 PS00135
  • CDD: cd00190
  • PDB: 1LZP 2ZGC 2ZGH 2ZGJ 2ZKS
  • PDBsum: 1LZP 2ZGC 2ZGH 2ZGJ 2ZKS
  • STRING: ENSP00000264553
• Other Databases: GeneCards:  GZMM  Malacards:  GZMM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008219	cell death	IEA	biological process
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0019835	cytolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0008236	serine-type peptidase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001913	T cell mediated cytotoxicity	IEA	biological process
GO:0004175	endopeptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0008219	cell death	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004252	serine-type endopeptidase activity	IMP	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq