Search Result
| Gene id | 30010 | ||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||
| Gene Symbol | NXPH1 Gene UCSC Ensembl | ||||||||||||||||||||
| Aliases | NPH1, Nbla00697 | ||||||||||||||||||||
| Gene name | neurexophilin 1 | ||||||||||||||||||||
| Alternate names | neurexophilin-1, | ||||||||||||||||||||
| Gene location |
7p21.3 (318818: 303351) Exons: 12 NC_000024.10 |
||||||||||||||||||||
| Gene summary(Entrez) |
This gene is a member of the neurexophilin family and encodes a secreted protein with a variable N-terminal domain, a highly conserved, N-glycosylated central domain, a short linker region, and a cysteine-rich C-terminal domain. This protein forms a very |
||||||||||||||||||||
| OMIM | 147310 | ||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||
| Protein general information | P58417 Name: Neurexophilin 1 Length: 271 Mass: 31082 | ||||||||||||||||||||
| Sequence |
MQAACWYVLFLLQPTVYLVTCANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLSQTFRGKENDTDLDLR YDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNGTFS VYFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQS HVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSG | ||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||
| Other Databases | GeneCards: NXPH1  Malacards: NXPH1 | ||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||
| |||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||
| |||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||
| |||||||||||||||||||||