• Gene id: 29989

Gene Summary

• Gene Symbol: OBP2B   Gene   UCSC   Ensembl
• Aliases: LCN14, OBPIIb
• Gene name: odorant binding protein 2B
• Alternate names: odorant-binding protein 2b, odorant-binding protein IIb,
• Gene location: 9q34.2 (133223254: 133205278)     Exons: 11     NC_000009.12
• OMIM: 605690

Protein Summary

• Protein general information: Q9NPH6  
  • Name: Odorant binding protein 2b (Odorant binding protein IIb) (OBPIIb)
  • Length: 170  
  • Mass: 19457
  • Tissue specificity: Strongly expressed in genital sphere organs such as the prostate and mammary glands.
• Sequence:

  MKTLFLGVTLGLAAALSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGKLEATFTFMREDRCI
  QKKILMRKTEEPGKYSAYGGRKLMYLQELPRRDHYIFYCKDQHHGGLLHMGKLVGRNSDTNREALEEFKKLVQRK
  GLSEEDIFTPLQTGSCVPEH

• Structural information:
  • Interpro: IPR012674  IPR002345  IPR000566  IPR002450  
  • STRING: ENSP00000484615
• Other Databases: GeneCards:  OBP2B  Malacards:  OBP2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0036094	small molecule binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0050896	response to stimulus	IEA	biological process
GO:0007608	sensory perception of smell	IEA	biological process
GO:0007635	chemosensory behavior	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005549	odorant binding	NAS	molecular function
GO:0007608	sensory perception of smell	NAS	biological process
GO:0005575	cellular_component	ND	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq