• Gene id: 29953

Gene Summary

• Gene Symbol: TRHDE   Gene   UCSC   Ensembl
• Aliases: PAP-II, PGPEP2, TRH-DE
• Gene name: thyrotropin releasing hormone degrading enzyme
• Alternate names: thyrotropin-releasing hormone-degrading ectoenzyme, TRH-degrading ectoenzyme, TRH-specific aminopeptidase, pyroglutamyl aminopeptidase II, pyroglutamyl-peptidase II, thyroliberinase,
• Gene location: 12q21.1 (72087287: 72666661)     Exons: 24     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the peptidase M1 family. The encoded protein is an extracellular peptidase that specifically cleaves and inactivates the neuropeptide thyrotropin-releasing hormone.[provided by RefSeq, Dec 2008]
• OMIM: 111100

Protein Summary

• Protein general information: Q9UKU6  
  • Name: Thyrotropin releasing hormone degrading ectoenzyme (TRH DE) (TRH degrading ectoenzyme) (EC 3.4.19.6) (Pyroglutamyl peptidase II) (PAP II) (TRH specific aminopeptidase) (Thyroliberinase)
  • Length: 1024  
  • Mass: 117000
  • Tissue specificity: Predominantly expressed in brain.
• Sequence:

  MGEDDAALRAGSRGLSDPWADSVGVRPRTTERHIAVHKRLVLAFAVSLVALLAVTMLAVLLSLRFDECGASATPG
  ADGGPSGFPERGGNGSLPGSARRNHHAGGDSWQPEAGGVASPGTTSAQPPSEEEREPWEPWTQLRLSGHLKPLHY
  NLMLTAFMENFTFSGEVNVEIACRNATRYVVLHASRVAVEKVQLAEDRAFGAVPVAGFFLYPQTQVLVVVLNRTL
  DAQRNYNLKIIYNALIENELLGFFRSSYVLHGERRFLGVTQFSPTHARKAFPCFDEPIYKATFKISIKHQATYLS
  LSNMPVETSVFEEDGWVTDHFSQTPLMSTYYLAWAICNFTYRETTTKSGVVVRLYARPDAIRRGSGDYALHITKR
  LIEFYEDYFKVPYSLPKLDLLAVPKHPYAAMENWGLSIFVEQRILLDPSVSSISYLLDVTMVIVHEICHQWFGDL
  VTPVWWEDVWLKEGFAHYFEFVGTDYLYPGWNMEKQRFLTDVLHEVMLLDGLASSHPVSQEVLQATDIDRVFDWI
  AYKKGAALIRMLANFMGHSVFQRGLQDYLTIHKYGNAARNDLWNTLSEALKRNGKYVNIQEVMDQWTLQMGYPVI
  TILGNTTAENRIIITQQHFIYDISAKTKALKLQNNSYLWQIPLTIVVGNRSHVSSEAIIWVSNKSEHHRITYLDK
  GSWLLGNINQTGYFRVNYDLRNWRLLIDQLIRNHEVLSVSNRAGLIDDAFSLARAGYLPQNIPLEIIRYLSEEKD
  FLPWHAASRALYPLDKLLDRMENYNIFNEYILKQVATTYIKLGWPKNNFNGSLVQASYQHEELRREVIMLACSFG
  NKHCHQQASTLISDWISSNRNRIPLNVRDIVYCTGVSLLDEDVWEFIWMKFHSTTAVSEKKILLEALTCSDDRNL
  LNRLLNLSLNSEVVLDQDAIDVIIHVARNPHGRDLAWKFFRDKWKILNTRYGEALFMNSKLISGVTEFLNTEGEL
  KELKNFMKNYDGVAAASFSRAVETVEANVRWKMLYQDELFQWLGKALRH

• Structural information:
  • Interpro: IPR042097  IPR024571  IPR034016  IPR001930  IPR014782   IPR015570  
  • Prosite: PS00142
  • CDD: cd09601
  • STRING: ENSP00000261180
• Other Databases: GeneCards:  TRHDE  Malacards:  TRHDE

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IBA	biological process
GO:0008270	zinc ion binding	IBA	molecular function
GO:0070006	metalloaminopeptidase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0042277	peptide binding	IBA	molecular function
GO:0043171	peptide catabolic process	IBA	biological process
GO:0004177	aminopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0008233	peptidase activity	IEA	molecular function
GO:0004177	aminopeptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0004177	aminopeptidase activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881