• Gene id: 29941

Gene Summary

• Gene Symbol: PKN3   Gene   UCSC   Ensembl
• Aliases: UTDP4-1
• Gene name: protein kinase N3
• Alternate names: serine/threonine-protein kinase N3, protein kinase PKN-beta, protein-kinase C-related kinase 3,
• Gene location: 9q34.11 (128702496: 128720917)     Exons: 10     NC_000009.12
• OMIM: 610714

Protein Summary

• Protein general information: Q6P5Z2  
  • Name: Serine/threonine protein kinase N3 (EC 2.7.11.13) (Protein kinase PKN beta) (Protein kinase C related kinase 3)
  • Length: 889  
  • Mass: 99421
  • Tissue specificity: Expressed in prostate tumors and various cancer cell lines. Not expressed in adult tissues. {ECO
• Sequence:

  MEEGAPRQPGPSQWPPEDEKEVIRRAIQKELKIKEGVENLRRVATDRRHLGHVQQLLRSSNRRLEQLHGELRELH
  ARILLPGPGPGPAEPVASGPRPWAEQLRARHLEALRRQLHVELKVKQGAENMTHTCASGTPKERKLLAAAQQMLR
  DSQLKVALLRMKISSLEASGSPEPGPELLAEELQHRLHVEAAVAEGAKNVVKLLSSRRTQDRKALAEAQAQLQES
  SQKLDLLRLALEQLLEQLPPAHPLRSRVTRELRAAVPGYPQPSGTPVKPTALTGTLQVRLLGCEQLLTAVPGRSP
  AAALASSPSEGWLRTKAKHQRGRGELASEVLAVLKVDNRVVGQTGWGQVAEQSWDQTFVIPLERARELEIGVHWR
  DWRQLCGVAFLRLEDFLDNACHQLSLSLVPQGLLFAQVTFCDPVIERRPRLQRQERIFSKRRGQDFLRASQMNLG
  MAAWGRLVMNLLPPCSSPSTISPPKGCPRTPTTLREASDPATPSNFLPKKTPLGEEMTPPPKPPRLYLPQEPTSE
  ETPRTKRPHMEPRTRRGPSPPASPTRKPPRLQDFRCLAVLGRGHFGKVLLVQFKGTGKYYAIKALKKQEVLSRDE
  IESLYCEKRILEAVGCTGHPFLLSLLACFQTSSHACFVTEFVPGGDLMMQIHEDVFPEPQARFYVACVVLGLQFL
  HEKKIIYRDLKLDNLLLDAQGFLKIADFGLCKEGIGFGDRTSTFCGTPEFLAPEVLTQEAYTRAVDWWGLGVLLY
  EMLVGECPFPGDTEEEVFDCIVNMDAPYPGFLSVQGLEFIQKLLQKCPEKRLGAGEQDAEEIKVQPFFRTTNWQA
  LLARTIQPPFVPTLCGPADLRYFEGEFTGLPPALTPPAPHSLLTARQQAAFRDFDFVSERFLEP

• Structural information:
  • Protein Domains: (5..8-)
    (/note="REM-1-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01207-)
    (93..16-)
    (/note="REM-1-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01207-)
    (165..24-)
    (/note="REM-1-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01207-)
    (-)
  • Interpro: IPR000961  IPR011072  IPR036274  IPR011009  IPR017892   IPR037313  IPR000719  IPR017441  IPR008271  
  • Prosite: PS51285 PS00107 PS50011 PS00108 PS51860
  • CDD: cd11622
  • STRING: ENSP00000291906
• Other Databases: GeneCards:  PKN3  Malacards:  PKN3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0010631	epithelial cell migration	IDA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0017049	GTP-Rho binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004672	protein kinase activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0006468	protein phosphorylation	TAS	biological process
GO:0005794	Golgi apparatus	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0004698	calcium-dependent protein kinase C activity	IEA	molecular function
GO:0004697	protein kinase C activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq