• Gene id: 29915

Gene Summary

• Gene Symbol: HCFC2   Gene   UCSC   Ensembl
• Aliases: HCF-2, HCF2
• Gene name: host cell factor C2
• Alternate names: host cell factor 2, C2 factor,
• Gene location: 12q23.3 (104064525: 104108953)     Exons: 17     NC_000012.12
• Gene summary(Entrez): This gene encodes one of two proteins which interact with VP16, a herpes simplex virus protein that initiates virus infection. Both the encoded protein and the original Herpes host cell factor interact with VP16 through a beta-propeller domain. The origin
• OMIM: 607926

Protein Summary

• Protein general information: Q9Y5Z7  
  • Name: Host cell factor 2 (HCF 2) (C2 factor)
  • Length: 792  
  • Mass: 86779
  • Tissue specificity: Highly expressed in testis. Detected at lower levels in spleen, thymus, prostate, ovary, small intestine and colon. {ECO
• Sequence:

  MAAPSLLNWRRVSSFTGPVPRARHGHRAVAIRELMIIFGGGNEGIADELHVYNTATNQWFLPAVRGDIPPGCAAH
  GFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVKPHPPPSGLPPCPRLGHSFSLYGNKCYLFGGLANESE
  DSNNNVPRYLNDFYELELQHGSGVVGWSIPVTKGVVPSPRESHTAVIYCKKDSGSPKMYVFGGMCGARLDDLWQL
  DLETMSWSKPETKGTVPLPRSLHTASVIGNKMYIFGGWVPHKGENTETSPHDCEWRCTSSFSYLNLDTTEWTTLV
  SDSQEDKKNSRPRPRAGHCAVAIGTRLYFWSGRDGYKKALNSQVCCKDLWYLDTEKPPAPSQVQLIKATTNSFHV
  KWDEVSTVEGYLLQLSTDLPYQAASSDSSAAPNMQGVRMDPHRQGSNNIVPNSINDTINSTKTEQPATKETSMKN
  KPDFKALTDSNAILYPSLASNASNHNSHVVDMLRKNEGPHTSANVGVLSSCLDVRTVIPETSVSSTVSSTQTMVT
  QQTIKTESSSTNGAVVKDETSLTTFSTKSEVDETYALPATKISRVETHATATPFSKETPSNPVATVKAGERQWCD
  VGIFKNNTALVSQFYLLPKGKQSISKVGNADVPDYSLLKKQDLVPGTGYRFRVAAINGCGIGPFSKISEFKTCIP
  GFPGAPSAVRISKNVEGIHLSWEPPTSPSGNILEYSAYLAIRTAQIQDNPSQLVFMRIYCGLKTSCIVTAGQLAN
  AHIDYTSRPAIVFRISAKNEKGYGPATQVRWLQGNNKKAPLN

• Structural information:
  • Protein Domains: (359..44-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (583..67-)
    2 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (677..78-)
    3 (/note="Fibronectin-type-III)
    (/e-)
  • Interpro: IPR003961  IPR036116  IPR011043  IPR037932  IPR013783   IPR015915  
  • Prosite: PS50853
  • CDD: cd00063
  • STRING: ENSP00000229330
• Other Databases: GeneCards:  HCFC2  Malacards:  HCFC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006338	chromatin remodeling	IBA	biological process
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0008134	transcription factor binding	IBA	molecular function
GO:0003682	chromatin binding	IBA	molecular function
GO:0005671	Ada2/Gcn5/Ada3 transcription activator complex	IBA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	ISS	biological process
GO:0071339	MLL1 complex	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003713	transcription coactivator activity	TAS	molecular function
GO:0016032	viral process	TAS	biological process
GO:0006357	regulation of transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:0005737	cytoplasm	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray