Search Result
| Gene id | 29893 | ||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | PSMC3IP Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||
| Aliases | GT198, HOP2, HUMGT198A, ODG3, TBPIP | ||||||||||||||||||||||||||||||||||||||||
| Gene name | PSMC3 interacting protein | ||||||||||||||||||||||||||||||||||||||||
| Alternate names | homologous-pairing protein 2 homolog, DBD-interacting, TBP-1-interacting protein, nuclear receptor coactivator GT198, proteasome 26S ATPase subunit 3-interacting protein, tat-binding protein 1-interacting protein, | ||||||||||||||||||||||||||||||||||||||||
| Gene location |
17q21.2 (105744648: 105894273) Exons: 9 NC_000002.12 |
||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a protein that functions in meiotic recombination. It is a subunit of the PSMC3IP/MND1 complex, which interacts with PSMC3/TBP1 to stimulate DMC1- and RAD51-mediated strand exchange during meiosis. The protein encoded by this gene can al |
||||||||||||||||||||||||||||||||||||||||
| OMIM | 608665 | ||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q9P2W1 Name: Homologous pairing protein 2 homolog (Nuclear receptor coactivator GT198) (PSMC3 interacting protein) (Proteasome 26S ATPase subunit 3 interacting protein) (Tat binding protein 1 interacting protein) (TBP 1 interacting protein) Length: 217 Mass: 24906 Tissue specificity: Highly expressed in testis and colon. {ECO | ||||||||||||||||||||||||||||||||||||||||
| Sequence |
MSKGRAEAAAGAAGILLRYLQEQNRPYSSQDVFGNLQREHGLGKAVVVKTLEQLAQQGKIKEKMYGKQKIYFADQ DQFDMVSDADLQVLDGKIVALTAKVQSLQQSCRYMEAELKELSSALTTPEMQKEIQELKKECAGYRERLKNIKAA TNHVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYPKSKKQFFEEVGIETDEDYNVTLPDP | ||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: PSMC3IP  Malacards: PSMC3IP | ||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||