• Gene id: 29889

Gene Summary

• Gene Symbol: GNL2   Gene   UCSC   Ensembl
• Aliases: HUMAUANTIG, NGP1, Ngp-1, Nog2, Nug2
• Gene name: G protein nucleolar 2
• Alternate names: nucleolar GTP-binding protein 2, autoantigen NGP-1, guanine nucleotide binding protein-like 2 (nucleolar), novel nucleolar guanosine 5'-triphosphate binding protein autoantigen, nucleolar G-protein gene 1, nucleolar GTPase, nucleostemin-2,
• Gene location: 1p34.3 (37595984: 37566811)     Exons: 18     NC_000001.11
• OMIM: 609365

Protein Summary

• Protein general information: Q13823  
  • Name: Nucleolar GTP binding protein 2 (Autoantigen NGP 1)
  • Length: 731  
  • Mass: 83655
  • Tissue specificity: Widely expressed, with the highest expression level in testis. {ECO
• Sequence:

  MVKPKYKGRSTINPSKASTNPDRVQGAGGQNMRDRATIRRLNMYRQKERRNSRGKIIKPLQYQSTVASGTVARVE
  PNIKWFGNTRVIKQSSLQKFQEEMDTVMKDPYKVVMKQSKLPMSLLHDRIRPHNLKVHILDTESFETTFGPKSQR
  KRPNLFASDMQSLIENAEMSTESYDQGKDRDLVTEDTGVRNEAQEEIYKKGQSKRIWGELYKVIDSSDVVVQVLD
  ARDPMGTRSPHIETYLKKEKPWKHLIFVLNKCDLVPTWATKRWVAVLSQDYPTLAFHASLTNPFGKGAFIQLLRQ
  FGKLHTDKKQISVGFIGYPNVGKSSVINTLRSKKVCNVAPIAGETKVWQYITLMRRIFLIDCPGVVYPSEDSETD
  IVLKGVVQVEKIKSPEDHIGAVLERAKPEYISKTYKIDSWENAEDFLEKLAFRTGKLLKGGEPDLQTVGKMVLND
  WQRGRIPFFVKPPNAEPLVAPQLLPSSSLEVVPEAAQNNPGEEVTETAGEGSESIIKEETEENSHCDANTEMQQI
  LTRVRQNFGKINVVPQFSGDDLVPVEVSDLEEELESFSDEEEEEQEQQRDDAEESSSEPEEENVGNDTKAVIKAL
  DEKIAKYQKFLDKAKAKKFSAVRISKGLSEKIFAKPEEQRKTLEEDVDDRAPSKKGKKRKAQREEEQEHSNKAPR
  ALTSKERRRAVRQQRPKKVGVRYYETHNVKNRNRNKKKTNDSEGQKHKRKKFRQKQ

• Structural information:
  • Protein Domains: (207..36-)
    (/note="CP-type-G)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01058"-)
  • Interpro: IPR030378  IPR023179  IPR006073  IPR024929  IPR012971   IPR027417  
  • Prosite: PS51721
  • STRING: ENSP00000362153
• Other Databases: GeneCards:  GNL2  Malacards:  GNL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005730	nucleolus	IBA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005525	GTP binding	NAS	molecular function
GO:0003924	GTPase activity	NAS	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0008150	biological_process	ND	biological process
GO:0005634	nucleus	TAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03008	Ribosome biogenesis in eukaryotes

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881