|
Gene id |
29802 |
| Gene Summary Protein Summary Gene ontology Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
VPREB3 Gene UCSC Ensembl |
|
Aliases |
8HS20, N27C7-2 |
|
Gene name |
V-set pre-B cell surrogate light chain 3 |
|
Alternate names |
pre-B lymphocyte protein 3, pre-B lymphocyte 3, pre-B lymphocyte gene 3, |
|
Gene location |
22q11 (23754424: 23752742) Exons: 2 NC_000022.11
|
|
Gene summary(Entrez) |
The protein encoded by this gene is the human ortholog of the mouse VpreB3 (8HS20) protein, is thought to be involved in B-cell maturation, and may play a role in assembly of the pre-B cell receptor (pre-BCR). While the role of this protein in B-cell deve
|
|
OMIM |
607434 |
Protein Summary
|
| Protein general information
| Q9UKI3
Name: Pre B lymphocyte protein 3 (N27C7 2) (Protein VPreB3)
Length: 123 Mass: 13710
Tissue specificity: Expressed in B-cell precursors. Expressed in fetal liver, bone marrow, spleen and lymph node.
|
| Sequence |
MACRCLSFLLMGTFLSVSQTVLAQLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEE DHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP
|
| Structural information |
|
| Other Databases |
GeneCards: VPREB3  Malacards: VPREB3 |
|
| GO accession | Term name | Evidence code | Go category |
|---|
| GO:0005615 |
extracellular space
|
IBA |
cellular component |
GO:0002377 |
immunoglobulin production
|
IBA |
biological process |
GO:0006955 |
immune response
|
IBA |
biological process |
GO:0005783 |
endoplasmic reticulum
|
NAS |
cellular component |
GO:0005576 |
extracellular region
|
TAS |
cellular component |
GO:0050900 |
leukocyte migration
|
TAS |
biological process |
|
|
| Associated diseases |
References |
| Spermatogenic defects | MIK: 31037746 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 31037746 |
Spermatoge nic defect s
|
|
|
16 (1 control, 15 cases)
|
Male infertility |
GSE6023 analyzed using GEO2R
|
Show abstract |
|