• Gene id: 29801

Gene Summary

• Gene Symbol: ZDHHC8   Gene   UCSC   Ensembl
• Aliases: DHHC8, ZDHHCL1, ZNF378
• Gene name: zinc finger DHHC-type palmitoyltransferase 8
• Alternate names: probable palmitoyltransferase ZDHHC8, membrane-associated DHHC8 zinc finger protein, zinc finger DHHC-type containing 8, zinc finger protein 378, zinc finger, DHHC domain like containing 1,
• Gene location: 22q11.21 (20131803: 20148006)     Exons: 11     NC_000022.11
• Gene summary(Entrez): This gene encodes a four transmembrane protein that is a member of the zinc finger DHHC domain-containing protein family. The encoded protein may function as a palmitoyltransferase. Defects in this gene may be associated with a susceptibility to schizophr
• OMIM: 608784

Protein Summary

• Protein general information: Q9ULC8  
  • Name: Probable palmitoyltransferase ZDHHC8 (EC 2.3.1.225) (Zinc finger DHHC domain containing protein 8) (DHHC 8) (Zinc finger protein 378)
  • Length: 765  
  • Mass: 81443
• Sequence:

  MPRSPGTRLKPAKYIPVATAAALLVGSSTLFFVFTCPWLTRAVSPAVPVYNGIIFLFVLANFSMATFMDPGVFPR
  ADEDEDKEDDFRAPLYKNVDVRGIQVRMKWCATCHFYRPPRCSHCSVCDNCVEDFDHHCPWVNNCIGRRNYRYFF
  LFLLSLSAHMVGVVAFGLVYVLNHAEGLGAAHTTITMAVMCVAGLFFIPVIGLTGFHVVLVTRGRTTNEQVTGKF
  RGGVNPFTRGCCGNVEHVLCSPLAPRYVVEPPRLPLAVSLKPPFLRPELLDRAAPLKVKLSDNGLKAGLGRSKSK
  GSLDRLDEKPLDLGPPLPPKIEAGTFSSDLQTPRPGSAESALSVQRTSPPTPAMYKFRPAFPTGPKVPFCGPGEQ
  VPGPDSLTLGDDSIRSLDFVSEPSLDLPDYGPGGLHAAYPPSPPLSASDAFSGALRSLSLKASSRRGGDHVALQP
  LRSEGGPPTPHRSIFAPHALPNRNGSLSYDSLLNPGSPGGHACPAHPAVGVAGYHSPYLHPGATGDPPRPLPRSF
  SPVLGPRPREPSPVRYDNLSRTIMASIQERKDREERERLLRSQADSLFGDSGVYDAPSSYSLQQASVLSEGPRGP
  ALRYGSRDDLVAGPGFGGARNPALQTSLSSLSSSVSRAPRTSSSSLQADQASSNAPGPRPSSGSHRSPARQGLPS
  PPGTPHSPSYAGPKAVAFIHTDLPEPPPSLTVQRDHPQLKTPPSKLNGQSPGLARLGPATGPPGPSASPTRHTLV
  KKVSGVGGTTYEISV

• Structural information:
  • Protein Domains: (104..15-)
    (/note="DHHC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00067"-)
  • Interpro: IPR001594  IPR030291  
  • Prosite: PS50216
  • STRING: ENSP00000384716
• Other Databases: GeneCards:  ZDHHC8  Malacards:  ZDHHC8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0016409	palmitoyltransferase activity	IBA	molecular function
GO:0018345	protein palmitoylation	IBA	biological process
GO:0010875	positive regulation of cholesterol efflux	IDA	biological process
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IDA	biological process
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IC	molecular function
GO:1903078	positive regulation of protein localization to plasma membrane	IC	biological process
GO:0016409	palmitoyltransferase activity	IEA	molecular function
GO:0018345	protein palmitoylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IEA	molecular function
GO:0034380	high-density lipoprotein particle assembly	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0019706	protein-cysteine S-palmitoyltransferase activity	TAS	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0007626	locomotory behavior	IEA	biological process
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0018345	protein palmitoylation	IDA	biological process
GO:0016409	palmitoyltransferase activity	IDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq