• Gene id: 2980

Gene Summary

• Gene Symbol: GUCA2A   Gene   UCSC   Ensembl
• Aliases: GCAP-I, GUCA2, STARA
• Gene name: guanylate cyclase activator 2A
• Alternate names: guanylin, guanylate cyclase activator 2A (guanylin 2, intestinal, heat-stable), guanylate cyclase-activating protein 1, guanylate cyclase-activating protein I, prepro-guanylin,
• Gene location: 1p34.2 (42164744: 42162689)     Exons: 3     NC_000001.11
• OMIM: 614088

Protein Summary

• Protein general information: Q02747  
  • Name: Guanylin (Guanylate cyclase activator 2A) (Guanylate cyclase activating protein 1) (Guanylate cyclase activating protein I) (GCAP I) [Cleaved into: HMW guanylin; Guanylin]
  • Length: 115  
  • Mass: 12388
  • Tissue specificity: Highly expressed in ileum and colon. Found in plasma.
• Sequence:

  MNAFLLSALCLLGAWAALAGGVTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFP
  EELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC

• Structural information:
  • Interpro: IPR000879  IPR036382  
  • PDB: 1GNA 1GNB 1O8R
  • PDBsum: 1GNA 1GNB 1O8R
  • STRING: ENSP00000349493
• Other Databases: GeneCards:  GUCA2A  Malacards:  GUCA2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030250	guanylate cyclase activator activity	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0030250	guanylate cyclase activator activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0007586	digestion	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030250	guanylate cyclase activator activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0031284	positive regulation of guanylate cyclase activity	IEA	biological process
GO:0031284	positive regulation of guanylate cyclase activity	IEA	biological process
GO:0031284	positive regulation of guanylate cyclase activity	IEA	biological process
GO:0031284	positive regulation of guanylate cyclase activity	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0030250	guanylate cyclase activator activity	NAS	molecular function
GO:0005576	extracellular region	NAS	cellular component
GO:0005179	hormone activity	NAS	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray