• Gene id: 2921

Gene Summary

• Gene Symbol: CXCL3   Gene   UCSC   Ensembl
• Aliases: CINC-2b, GRO3, GROg, MIP-2b, MIP2B, SCYB3
• Gene name: C-X-C motif chemokine ligand 3
• Alternate names: C-X-C motif chemokine 3, GRO-gamma, GRO-gamma(1-73), GRO3 oncogene, MGSA gamma, MIP2-beta, chemokine (C-X-C motif) ligand 3, growth-regulated protein gamma, macrophage inflammatory protein 2-beta, melanoma growth stimulatory activity gamma,
• Gene location: 4q13.3 (74038688: 74036588)     Exons: 4     NC_000004.12
• Gene summary(Entrez): This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattra
• OMIM: 605891

Protein Summary

• Protein general information: P19876  
  • Name: C X C motif chemokine 3 (GRO gamma(1 73)) (Growth regulated protein gamma) (GRO gamma) (Macrophage inflammatory protein 2 beta) (MIP2 beta) [Cleaved into: GRO gamma(5 73)]
  • Length: 107  
  • Mass: 11342
• Sequence:

  MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVI
  ATLKNGKKACLNPASPMVQKIIEKILNKGSTN

• Structural information:
  • Interpro: IPR001089  IPR018048  IPR001811  IPR033899  IPR036048  
  • Prosite: PS00471
  • CDD: cd00273
  • DIP: 5909
  • STRING: ENSP00000296026
• Other Databases: GeneCards:  CXCL3  Malacards:  CXCL3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045236	CXCR chemokine receptor binding	IBA	molecular function
GO:0030595	leukocyte chemotaxis	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0071222	cellular response to lipopolysaccharide	IBA	biological process
GO:0070098	chemokine-mediated signaling pathway	IBA	biological process
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IBA	biological process
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0008009	chemokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0006952	defense response	IEA	biological process
GO:0008009	chemokine activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0030593	neutrophil chemotaxis	ISS	biological process
GO:0008009	chemokine activity	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04621	NOD-like receptor signaling pathway
hsa04668	TNF signaling pathway
hsa04064	NF-kappa B signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa05146	Amoebiasis
hsa04657	IL-17 signaling pathway
hsa05323	Rheumatoid arthritis
hsa05120	Epithelial cell signaling in Helicobacter pylori infection
hsa05134	Legionellosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881