• Gene id: 29106

Gene Summary

• Gene Symbol: SCG3   Gene   UCSC   Ensembl
• Aliases: SGIII
• Gene name: secretogranin III
• Alternate names: secretogranin-3,
• Gene location: 15q21.2 (51681352: 51721025)     Exons: 12     NC_000015.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Granins may serve as precursors for biologically active peptides. Some granins have been shown to function as helper proteins in so
• OMIM: 611796

Protein Summary

• Protein general information: Q8WXD2  
  • Name: Secretogranin 3 (Secretogranin III) (SgIII)
  • Length: 468  
  • Mass: 53005
  • Tissue specificity: Expressed in brain, heart, kidney, liver and skeletal muscle. {ECO
• Sequence:

  MGFLGTGTWILVLVLPIQAFPKPGGSQDKSLHNRELSAERPLNEQIAEAEEDKIKKTYPPENKPGQSNYSFVDNL
  NLLKAITEKEKIEKERQSIRSSPLDNKLNVEDVDSTKNRKLIDDYDSTKSGLDHKFQDDPDGLHQLDGTPLTAED
  IVHKIAARIYEENDRAVFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGK
  IPEKVTPMAAIQDGLAKGENDETVSNTLTLTNGLERRTKTYSEDNFEELQYFPNFYALLKSIDSEKEAKEKETLI
  TIMKTLIDFVKMMVKYGTISPEEGVSYLENLDEMIALQTKNKLEKNATDNISKLFPAPSEKSHEETDSTKEEAAK
  MEKEYGSLKDSTKDDNSNPGGKTDEPKGKTEAYLEAIRKNIEWLKKHDKKGNKEDYDLSKMRDFINKQADAYVEK
  GILDKEEAEAIKRIYSSL

• Structural information:
  • Interpro: IPR026197  
  • DIP: 29451
  • STRING: ENSP00000220478
• Other Databases: GeneCards:  SCG3  Malacards:  SCG3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030667	secretory granule membrane	IBA	cellular component
GO:0033366	protein localization to secretory granule	IBA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0002576	platelet degranulation	TAS	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0034774	secretory granule lumen	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0033366	protein localization to secretory granule	IEA	biological process
GO:0030667	secretory granule membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0030133	transport vesicle	IEA	cellular component
GO:0030658	transport vesicle membrane	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881