|
Gene id |
29087 |
| Gene Summary Protein Summary Gene ontology Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
THYN1 Gene UCSC Ensembl |
|
Aliases |
HSPC144, MDS012, MY105, THY28, THY28KD |
|
Gene name |
thymocyte nuclear protein 1 |
|
Alternate names |
thymocyte nuclear protein 1, thymocyte protein thy28, |
|
Gene location |
11q25 (134253351: 134248281) Exons: 8 NC_000011.10
|
|
Gene summary(Entrez) |
This gene encodes a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul
|
|
OMIM |
609956 |
Protein Summary
|
| Protein general information
| Q9P016
Name: Thymocyte nuclear protein 1 (Thymocyte protein Thy28)
Length: 225 Mass: 25697
|
| Sequence |
MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLKNLSSHWLMKSEPESRLEKGVDVKF SIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPS SKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQEEFDFVLSLEEKEPS
|
| Structural information |
|
| Other Databases |
GeneCards: THYN1  Malacards: THYN1 |
|
|
|
|
| Associated diseases |
References |
| Cryptorchidism | MIK: 28606200 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 28606200 |
Cryptorchi dism
|
|
|
Monozgotic twin s (1 control, I cwith cryptorc hidism)
|
Male infertility |
MeDIP-Seq
|
Show abstract |
|