Search Result
| Gene id | 29071 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | C1GALT1C1 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | C1GALT2, C38H2-L1, COSMC, HSPC067, MST143, TNPS | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | C1GALT1 specific chaperone 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | C1GALT1-specific chaperone 1, C38H2-like protein 1, beta 1,3-galactosyltransferase 2, core 1 beta1,3-galactosyltransferase 2, core 1 beta3-Gal-T2, core 1 beta3-galactosyltransferase-specific molecular chaperone, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
Xq24 (120630149: 120625673) Exons: 3 NC_000023.11 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a type II transmembrane protein that is similar to the core 1 beta1,3-galactosyltransferase 1, which catalyzes the synthesis of the core-1 structure, also known as Thomsen-Friedenreich antigen, on O-linked glycans. This gene product lack |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 300611 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q96EU7 Name: C1GALT1 specific chaperone 1 (C38H2 like protein 1) (C38H2 L1) (Core 1 beta1,3 galactosyltransferase 2) (C1Gal T2) (C1GalT2) (Core 1 beta3 Gal T2) (Core 1 beta3 galactosyltransferase specific molecular chaperone) Length: 318 Mass: 36382 Tissue specificity: Ubiquitously expressed. Abundantly expressed in salivary gland, stomach, small intestine, kidney, and testis and at intermediate levels in whole brain, cerebellum, spinal cord, thymus, spleen, trachea, lung, pancreas, ovary, and uterus | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MLSESSSFLKGVMLGSIFCALITMLGHIRIGHGNRMHHHEHHHLQAPNKEDILKISEDERMELSKSFRVYCIILV KPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAI IENLKYFLLKKDPSQPFYLGHTIKSGDLEYVGMEGGIVLSVESMKRLNSLLNIPEKCPEQGGMIWKISEDKQLAV CLKYAGVFAENAEDADGKDVFNTKSVGLSIKEAMTYHPNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFG HIFNDALVFLPPNGSDND | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: C1GALT1C1  Malacards: C1GALT1C1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
KEGG pathways
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||