• Gene id: 29062

Gene Summary

• Gene Symbol: WDR91   Gene   UCSC   Ensembl
• Aliases: HSPC049, SORF-1, SORF1
• Gene name: WD repeat domain 91
• Alternate names: WD repeat-containing protein 91,
• Gene location: 7q33 (135211555: 135183838)     Exons: 17     NC_000007.14
• OMIM: 616303

Protein Summary

• Protein general information: A4D1P6  
  • Name: WD repeat containing protein 91
  • Length: 747  
  • Mass: 83344
• Sequence:

  MAEAVERTDELVREYLLFRGFTHTLRQLDAEIKADKEKGFRVDKIVDQLQQLMQVYDLAALRDYWSYLERRLFSR
  LEDIYRPTIHKLKTSLFRFYLVYTIQTNRNDKAQEFFAKQATELQNQAEWKDWFVLPFLPSPDTNPTFATYFSRQ
  WADTFIVSLHNFLSVLFQCMPVPVILNFDAECQRTNQVQEENEVLRQKLFALQAEIHRLKKEEQQPEEEEALVQH
  KLPPYVSNMDRLGDSELAMVCSQRNASLSQSPRVGFLSSLLPQSKKSPSRLSPAQGPPQPQSSAKKESFGGQGTK
  GKDPTSGAKDGKSLLSGLATGESGWSQHRQRRLQDHGKERKELFSTTTSQCAEKKPEASGPEAEPCPELHTEPVE
  PLTRASSAGPEGGGVRPEQPFIVLGQEEYGEHHSSIMHCRVDCSGRRVASLDVDGVIKVWSFNPIMQTKASSISK
  SPLLSLEWATKRDRLLLLGSGVGTVRLYDTEAKKNLCEININDNMPRILSLACSPNGASFVCSAAAPSLTSQVDF
  SAPDIGSKGMNQVPGRLLLWDTKTMKQQLQFSLDPEPIAINCTAFNHNGNLLVTGAADGVIRLFDMQQHECAMSW
  RAHYGEVYSVEFSYDENTVYSIGEDGKFIQWNIHKSGLKVSEYSLPSDATGPFVLSGYSGYKQVQVPRGRLFAFD
  SEGNYMLTCSATGGVIYKLGGDEKVLESCLSLGGHRAPVVTVDWSTAMDCGTCLTASMDGKIKLTTLLAHKA

• Structural information:
  • Interpro: IPR015943  IPR001680  IPR017986  IPR036322  IPR039724  
  • Prosite: PS50082 PS50294
  • STRING: ENSP00000346466
• Other Databases: GeneCards:  WDR91  Malacards:  WDR91

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031902	late endosome membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0031902	late endosome membrane	IDA	cellular component
GO:0031901	early endosome membrane	IDA	cellular component
GO:0031313	extrinsic component of endosome membrane	IDA	cellular component
GO:0043551	regulation of phosphatidylinositol 3-kinase activity	IMP	biological process
GO:0035014	phosphatidylinositol 3-kinase regulator activity	IMP	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IMP	NOT|biological process
GO:0005515	protein binding	IPI	molecular function
GO:0045022	early endosome to late endosome transport	IMP	biological process
GO:1903362	regulation of cellular protein catabolic process	IMP	biological process
GO:0045022	early endosome to late endosome transport	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0043551	regulation of phosphatidylinositol 3-kinase activity	IEA	biological process
GO:0045022	early endosome to late endosome transport	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031901	early endosome membrane	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)