• Gene id: 29015

Gene Summary

• Gene Symbol: SLC43A3   Gene   UCSC   Ensembl
• Aliases: EEG1, ENBT1, FOAP-13, PRO1659, SEEEG-1
• Gene name: solute carrier family 43 member 3
• Alternate names: solute carrier family 43 member 3, likely ortholog of mouse embryonic epithelial gene 1,
• Gene location: 11q12.1 (57427579: 57406953)     Exons: 15     NC_000011.10
• OMIM: 147138

Protein Summary

• Protein general information: Q8NBI5  
  • Name: Solute carrier family 43 member 3 (Protein FOAP 13)
  • Length: 491  
  • Mass: 54529
  • Tissue specificity: Highly expressed in macrophages. {ECO
• Sequence:

  MAGQGLPLHVATLLTGLLECLGFAGVLFGWPSLVFVFKNEDYFKDLCGPDAGPIGNATGQADCKAQDERFSLIFT
  LGSFMNNFMTFPTGYIFDRFKTTVARLIAIFFYTTATLIIAFTSAGSAVLLFLAMPMLTIGGILFLITNLQIGNL
  FGQHRSTIITLYNGAFDSSSAVFLIIKLLYEKGISLRASFIFISVCSTWHVARTFLLMPRGHIPYPLPPNYSYGL
  CPGNGTTKEEKETAEHENRELQSKEFLSAKEETPGAGQKQELRSFWSYAFSRRFAWHLVWLSVIQLWHYLFIGTL
  NSLLTNMAGGDMARVSTYTNAFAFTQFGVLCAPWNGLLMDRLKQKYQKEARKTGSSTLAVALCSTVPSLALTSLL
  CLGFALCASVPILPLQYLTFILQVISRSFLYGSNAAFLTLAFPSEHFGKLFGLVMALSAVVSLLQFPIFTLIKGS
  LQNDPFYVNVMFMLAILLTFFHPFLVYRECRTWKESPSAIA

• Structural information:
  • Interpro: IPR011701  IPR036259  IPR027197  
  • STRING: ENSP00000434515
• Other Databases: GeneCards:  SLC43A3  Malacards:  SLC43A3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R