• Gene id: 28982

Gene Summary

• Gene Symbol: FLVCR1   Gene   UCSC   Ensembl
• Aliases: AXPC1, FLVCR, MFSD7B, PCA, PCARP, SLC49A1
• Gene name: FLVCR heme transporter 1
• Alternate names: feline leukemia virus subgroup C receptor-related protein 1, feline leukemia virus subgroup C cellular receptor 1,
• Gene location: 1q32.3 (212858274: 212899362)     Exons: 13     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the major facilitator superfamily of transporter proteins. The encoded protein is a heme transporter that may play a critical role in erythropoiesis by protecting developing erythroid cells from heme toxicity. This gene may p
• OMIM: 609144

Protein Summary

• Protein general information: Q9Y5Y0  
  • Name: Feline leukemia virus subgroup C receptor related protein 1 (Feline leukemia virus subgroup C receptor) (hFLVCR)
  • Length: 555  
  • Mass: 59863
  • Tissue specificity: Found all hematopoietic tissues including peripheral blood lymphocytes. Some expression is found in pancreas and kidney. {ECO
• Sequence:

  MARPDDEEGAAVAPGHPLAKGYLPLPRGAPVGKESVELQNGPKAGTFPVNGAPRDSLAAASGVLGGPQTPLAPEE
  ETQARLLPAGAGAETPGAESSPLPLTALSPRRFVVLLIFSLYSLVNAFQWIQYSIISNVFEGFYGVTLLHIDWLS
  MVYMLAYVPLIFPATWLLDTRGLRLTALLGSGLNCLGAWIKCGSVQQHLFWVTMLGQCLCSVAQVFILGLPSRIA
  SVWFGPKEVSTACATAVLGNQLGTAVGFLLPPVLVPNTQNDTNLLACNISTMFYGTSAVATLLFILTAIAFKEKP
  RYPPSQAQAALQDSPPEEYSYKKSIRNLFKNIPFVLLLITYGIMTGAFYSVSTLLNQMILTYYEGEEVNAGRIGL
  TLVVAGMVGSILCGLWLDYTKTYKQTTLIVYILSFIGMVIFTFTLDLRYIIIVFVTGGVLGFFMTGYLPLGFEFA
  VEITYPESEGTSSGLLNASAQIFGILFTLAQGKLTSDYGPKAGNIFLCVWMFIGIILTALIKSDLRRHNINIGIT
  NVDVKAIPADSPTDQEPKTVMLSKQSESAI

• Structural information:
  • Interpro: IPR011701  IPR020846  IPR036259  
  • Prosite: PS50850
  • STRING: ENSP00000355938
• Other Databases: GeneCards:  FLVCR1  Malacards:  FLVCR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0097037	heme export	IBA	biological process
GO:0030218	erythrocyte differentiation	IBA	biological process
GO:0020037	heme binding	IBA	molecular function
GO:0015232	heme transmembrane transporter activity	IBA	molecular function
GO:0006839	mitochondrial transport	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0015232	heme transmembrane transporter activity	IDA	molecular function
GO:0097037	heme export	IMP	biological process
GO:0015232	heme transmembrane transporter activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0043249	erythrocyte maturation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030218	erythrocyte differentiation	IDA	biological process
GO:0006839	mitochondrial transport	IDA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0015886	heme transport	IMP	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0006879	cellular iron ion homeostasis	TAS	biological process
GO:0015232	heme transmembrane transporter activity	TAS	molecular function
GO:0030218	erythrocyte differentiation	IEA	biological process
GO:0046620	regulation of organ growth	IEA	biological process
GO:0060323	head morphogenesis	IEA	biological process
GO:0001568	blood vessel development	IEA	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0035108	limb morphogenesis	IEA	biological process
GO:0035264	multicellular organism growth	IEA	biological process
GO:0042733	embryonic digit morphogenesis	IEA	biological process
GO:0048536	spleen development	IEA	biological process
GO:0048704	embryonic skeletal system morphogenesis	IEA	biological process
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Posterior column ataxia with retinitis pigmentosa	KEGG:H01036
Posterior column ataxia with retinitis pigmentosa	KEGG:H01036
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray