• Gene id: 28969

Gene Summary

• Gene Symbol: BZW2   Gene   UCSC   Ensembl
• Aliases: HSPC028, MST017, MSTP017
• Gene name: basic leucine zipper and W2 domains 2
• Alternate names: basic leucine zipper and W2 domain-containing protein 2,
• Gene location: 7p21.1 (16646133: 16706522)     Exons: 15     NC_000007.14

Protein Summary

• Protein general information: Q9Y6E2  
  • Name: Basic leucine zipper and W2 domain containing protein 2
  • Length: 419  
  • Mass: 48162
• Sequence:

  MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAG
  SMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFLKAFSETEQTK
  LAMLSGILLGNGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLELFPVNRQ
  SVDHFAKYFTDAGLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTC
  IMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYCYDNIHFMKAFQKIVVLFYKADVLSE
  EAILKWYKEAHVAKGKSVFLDQMKKFVEWLQNAEEESESEGEEN

• Structural information:
  • Protein Domains: (248..41-)
    (/note="W2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00695"-)
  • Interpro: IPR016024  IPR016021  IPR003307  
  • Prosite: PS51363
  • STRING: ENSP00000397249
• Other Databases: GeneCards:  BZW2  Malacards:  BZW2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881