• Gene id: 28951

Gene Summary

• Gene Symbol: TRIB2   Gene   UCSC   Ensembl
• Aliases: C5FW, GS3955, TRB2
• Gene name: tribbles pseudokinase 2
• Alternate names: tribbles homolog 2,
• Gene location: 2p24.3 (12716871: 12742733)     Exons: 3     NC_000002.12
• Gene summary(Entrez): This gene encodes one of three members of the Tribbles family. The Tribbles members share a Trb domain, which is homologous to protein serine-threonine kinases, but lacks the active site lysine and probably lacks a catalytic function. The Tribbles protein
• OMIM: 136538

Protein Summary

• Protein general information: Q92519  
  • Name: Tribbles homolog 2 (TRB 2)
  • Length: 343  
  • Mass: 38801
  • Tissue specificity: Highly expressed in peripheral blood leukocytes. {ECO
• Sequence:

  MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPLEGDHV
  FRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSFVRTCKKLREE
  EAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLSDKHGCPAYVSPEILN
  TSGSYSGKAADVWSLGVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQ
  EILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN

• Structural information:
  • Protein Domains: (61..30-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR024104  
  • Prosite: PS50011
  • STRING: ENSP00000155926
• Other Databases: GeneCards:  TRIB2  Malacards:  TRIB2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0043405	regulation of MAP kinase activity	IBA	biological process
GO:0031434	mitogen-activated protein kinase kinase binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0004860	protein kinase inhibitor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0055106	ubiquitin-protein transferase regulator activity	IEA	molecular function
GO:0008134	transcription factor binding	IEA	molecular function
GO:0045599	negative regulation of fat cell differentiation	IEA	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0031625	ubiquitin protein ligase binding	IEA	molecular function
GO:0031625	ubiquitin protein ligase binding	ISS	molecular function
GO:0008134	transcription factor binding	ISS	molecular function
GO:0055106	ubiquitin-protein transferase regulator activity	ISS	molecular function
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	ISS	biological process
GO:0045081	negative regulation of interleukin-10 biosynthetic process	IMP	biological process
GO:0045599	negative regulation of fat cell differentiation	ISS	biological process
GO:0006469	negative regulation of protein kinase activity	NAS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0043405	regulation of MAP kinase activity	ISS	biological process
GO:0006468	protein phosphorylation	ISS	NOT|biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0004672	protein kinase activity	ISS	NOT|molecular function
GO:0000166	nucleotide binding	ISS	NOT|molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray