• Gene id: 286826

Gene Summary

• Gene Symbol: LIN9   Gene   UCSC   Ensembl
• Aliases: BARA, BARPsv, Lin-9, TGS, TGS1, TGS2
• Gene name: lin-9 DREAM MuvB core complex component
• Alternate names: protein lin-9 homolog, TUDOR gene similar protein, beta subunit-associated regulator of apoptosis, lin-9 homolog, pRB-associated protein, rb related pathway actor, type I interferon receptor beta chain-associated protein,
• Gene location: 1q42.12 (226310081: 226231148)     Exons: 18     NC_000001.11
• Gene summary(Entrez): This gene encodes a tumor suppressor protein that inhibits DNA synthesis and oncogenic transformation through association with the retinoblastoma 1 protein. The encoded protein also interacts with a complex of other cell cycle regulators to repress cell c
• OMIM: 605414

Protein Summary

• Protein general information: Q5TKA1  
  • Name: Protein lin 9 homolog (HuLin 9) (hLin 9) (Beta subunit associated regulator of apoptosis) (TUDOR gene similar protein) (Type I interferon receptor beta chain associated protein) (pRB associated protein)
  • Length: 542  
  • Mass: 61946
  • Tissue specificity: Expressed in thymus and testis. {ECO
• Sequence:

  MAELDQLPDESSSAKALVSLKEGSLSNTWNEKYSSLQKTPVWKGRNTSSAVEMPFRNSKRSRLFSDEDDRQINTR
  SPKRNQRVAMVPQKFTATMSTPDKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESF
  PNLKTRKLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFKDLPDEIPLPLVIGTK
  VTARLRGVHDGLFTGQIDAVDTLNATYRVTFDRTGLGTHTIPDYEVLSNEPHETMPIAAFGQKQRPSRFFMTPPR
  LHYTPPLQSPIIDNDPLLGQSPWRSKISGSDTETLGGFPVEFLIQVTRLSKILMIKKEHIKKLREMNTEAEKLKS
  YSMPISIEFQRRYATIVLELEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRHANSST
  GQPCVENENLTDLISRLTAILLQIKCLAEGGDLNSFEFKSLTDSLNDIKSTIDASNISCFQNNVEIHVAHIQSGL
  SQMGNLHAFAANNTNRD

• Structural information:
  • Interpro: IPR033471  IPR010561  
  • PDB: 6C48
  • PDBsum: 6C48
  • STRING: ENSP00000329102
• Other Databases: GeneCards:  LIN9  Malacards:  LIN9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003677	DNA binding	IBA	molecular function
GO:0000003	reproduction	IBA	biological process
GO:0005654	nucleoplasm	IBA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0051726	regulation of cell cycle	IBA	biological process
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0017053	transcription repressor complex	IEA	cellular component
GO:0071897	DNA biosynthetic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0051726	regulation of cell cycle	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04218	Cellular senescence

Diseases

Associated diseases	References
Male factor infertility	MIK: 29961538

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq