• Gene id: 286205

Gene Summary

• Gene Symbol: SCAI   Gene   UCSC   Ensembl
• Aliases: C9orf126, NET40
• Gene name: suppressor of cancer cell invasion
• Alternate names: protein SCAI, suppressor of cancer cell invasion protein,
• Gene location: 9q33.3 (35795706: 35756248)     Exons: 14     NC_000017.11
• Gene summary(Entrez): This gene encodes a regulator of cell migration. The encoded protein appears to function in the RhoA (ras homolog gene family, member A)-Dia1 (diaphanous homolog 1) signal transduction pathway. Alternatively spliced transcript variants have been described

Protein Summary

• Protein general information: Q8N9R8  
  • Name: Protein SCAI (Suppressor of cancer cell invasion protein)
  • Length: 606  
  • Mass: 70399
• Sequence:

  MVRGARQPQQPRSRLAPRLTGTVEKPPRKRRSRTEFALKEIMSSGGAEDDIPQGERKTVTDFCYLLDKSKQLFNG
  LRDLPQYGQKQWQSYFGRTFDVYTKLWKFQQQHRQVLDNRYGLKRWQIGEIASKIGQLYYHYYLRTSETSYLNEA
  FSFYSAIRQRSYYSQVNKEDRPELVVKKLRYYARFIVVCLLLNKMDVVKDLVKELSDEIEDYTHRFNTEDQVEWN
  LVLQEVAAFIEADPVMVLNDDNTIVITSNRLAETGAPLLEQGMIVGQLSLADALIIGNCNNQVKFSELTVDMFRM
  LQALEREPMNLASQMNKPGMQESADKPTRRENPHKYLLYKPTFSQLYTFLAASFKELPANSVLLIYLSATGVFPT
  GRSDSEGPYDFGGVLTNSNRDIINGDAIHKRNQSHKEMHCLHPGDLYPFTRKPLFIIVDSSNSVAYKNFTNLFGQ
  PLVCLLSPTAYPKALQDQSQRGSLFTLFLNNPLMAFLFVSGLSSMRRGLWEKCQEYLRKINRDIAQLLTHSRSID
  QAFLQFFGDEFLRLLLTRFIFCSATMRMHKIFRETRNYPESYPQLPRDETVENPHLQKHILELASILDVRNVFFE
  NTIDDY

• Structural information:
  • Interpro: IPR022709  IPR016607  
  • STRING: ENSP00000362650
• Other Databases: GeneCards:  SCAI  Malacards:  SCAI

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030336	negative regulation of cell migration	IEA	biological process
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0035024	negative regulation of Rho protein signal transduction	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:1903507	negative regulation of nucleic acid-templated transcription	IEA	biological process
GO:1903507	negative regulation of nucleic acid-templated transcription	IEA	biological process
GO:1903507	negative regulation of nucleic acid-templated transcription	IEA	biological process
GO:1903507	negative regulation of nucleic acid-templated transcription	IEA	biological process
GO:0035024	negative regulation of Rho protein signal transduction	ISS	biological process
GO:0003714	transcription corepressor activity	IMP	molecular function
GO:0030336	negative regulation of cell migration	IMP	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)