• Gene id: 286046

Gene Summary

• Gene Symbol: XKR6   Gene   UCSC   Ensembl
• Aliases: C8orf21, C8orf5, C8orf7, XRG6
• Gene name: XK related 6
• Alternate names: XK-related protein 6, Transmembrane protein C8orf5, X Kell blood group precursor-related family, member 6, X-linked Kx blood group related 6, XK, Kell blood group complex subunit-related family, member 6,
• Gene location: 8p23.1 (11201832: 10893763)     Exons: 6     NC_000008.11
• OMIM: 0

Protein Summary

• Protein general information: Q5GH73  
  • Name: XK related protein 6
  • Length: 641  
  • Mass: 71638
• Sequence:

  MAAKSDGGGVGVGFAQLHNLDEAVGSGGEEDGEPGGGGCGGGGDGSEPGESSSMHICHCCNTSSCYWGCRSACLR
  SLLGRKPRRSAAADGGDQPLQPPAAPGAGRQPPTPSAARPEPPPPQVERPWLDCLWIVLALLVFFGDVGTDLWLA
  LDYYRKGDYVYFGLTLFFVLVPSLLVQSLSFRWFVQDYTGGGLGAVEGLTSRGPPMMGAGYVHGAARGGPGVRVS
  PTPGAQRLCRLSVWIWQSVIHLLQMGQVWRYIRTMYLGIQSQRRKEHQRRFYWAMMYEYADVNMLRLLETFLESA
  PQLVLQLYIMLQKNSAETLPCVSSVTSLMSLAWVLASYHKLLRDSRDDKKSMSYRGAIIQVFWRLFTISSRVISF
  ALFASIFQLYFGIFVVVHWCAMAFWIIHGGTDFCMSKWEEILFNMVVGIVYIFCWFNVKEGRTRYRMFAYYTIVL
  TENAALTFLWYFYRDPETTDSYAVPALCCVFISFVAGIAMMLLYYGVLHPTGPRAKILASSCCAELLWGIPLPPD
  VEPMAPEIPGYRGTQVTPTRAVTEQQEDLTADTCLPVFQVRPMGPPTPLGRPYLPEGPLIKIDMPRKRYPAWDAH
  FVDRRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL

• Structural information:
  • Interpro: IPR018629  
  • STRING: ENSP00000416707
• Other Databases: GeneCards:  XKR6  Malacards:  XKR6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0016020	membrane	IBA	cellular component
GO:0043652	engulfment of apoptotic cell	IBA	biological process
GO:0070782	phosphatidylserine exposure on apoptotic cell surface	IBA	biological process
GO:1902742	apoptotic process involved in development	IBA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq