• Gene id: 285973

Gene Summary

• Gene Symbol: ATG9B   Gene   UCSC   Ensembl
• Aliases: APG9L2, NOS3AS, SONE
• Gene name: autophagy related 9B
• Alternate names: autophagy-related protein 9B, APG9-like 2, ATG9 autophagy related 9 homolog B, autophagy 9-like 2 protein, endothelial nitric oxide synthase antisense, nitric oxide synthase 3-overlapping antisense gene protein,
• Gene location: 7q36.1 (151028266: 151012208)     Exons: 23     NC_000007.14
• Gene summary(Entrez): This gene functions in the regulation of autophagy, a lysosomal degradation pathway. This gene also functions as an antisense transcript in the posttranscriptional regulation of the endothelial nitric oxide synthase 3 gene, which has 3' overlap with this
• OMIM: 611410

Protein Summary

• Protein general information: Q674R7  
  • Name: Autophagy related protein 9B (APG9 like 2) (Nitric oxide synthase 3 overlapping antisense gene protein) (Protein sONE)
  • Length: 924  
  • Mass: 101019
  • Tissue specificity: Highly expressed in placenta (trophoblast cells) and pituitary gland. Not expressed in vascular endothelial. {ECO
• Sequence:

  MVSRMGWGGRRRRLGRWGDLGPGSVPLLPMPLPPPPPPSCRGPGGGRISIFSLSPAPHTRSSPSSFSPPTAGPPC
  SVLQGTGASQSCHSALPIPATPPTQAQPAMTPASASPSWGSHSTPPLAPATPTPSQQCPQDSPGLRVGPLIPEQD
  YERLEDCDPEGSQDSPIHGEEQQPLLHVPEGLRGSWHHIQNLDSFFTKIYSYHQRNGFACILLEDVFQLGQFIFI
  VTFTTFLLRCVDYNVLFANQPSNHTRPGPFHSKVTLSDAILPSAQCAERIRSSPLLVLLLVLAAGFWLVQLLRSV
  CNLFSYWDIQVFYREALHIPPEELSSVPWAEVQSRLLALQRSGGLCVQPRPLTELDIHHRILRYTNYQVALANKG
  LLPARCPLPWGGSAAFLSRGLALNVDLLLFRGPFSLFRGGWELPHAYKRSDQRGALAARWGRTVLLLAALNLALS
  PLVLAWQVLHVFYSHVELLRREPGALGARGWSRLARLQLRHFNELPHELRARLARAYRPAAAFLRTAAPPAPLRT
  LLARQLVFFAGALFAALLVLTVYDEDVLAVEHVLTAMTALGVTATVARSFIPEEQCQGRAPQLLLQTALAHMHYL
  PEEPGPGGRDRAYRQMAQLLQYRAVSLLEELLSPLLTPLFLLFWFRPRALEIIDFFHHFTVDVAGVGDICSFALM
  DVKRHGHPQWLSAGQTEASLSQRAEDGKTELSLMRFSLAHPLWRPPGHSSKFLGHLWGRVQQDAAAWGATSARGP
  STPGVLSNCTSPLPEAFLANLFVHPLLPPRDLSPTAPCPAAATASLLASISRIAQDPSSVSPGGTGGQKLAQLPE
  LASAEMSLHVIYLHQLHQQQQQQEPWGEAAASILSRPCSSPSQPPSPDEEKPSWSSDGSSPASSPRQQWGTQKAR
  NLFPGGFQVTTDTQKEPDRASCTD

• Structural information:
  • Interpro: IPR007241  
• Other Databases: GeneCards:  ATG9B  Malacards:  ATG9B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000045	autophagosome assembly	IBA	biological process
GO:0000422	autophagy of mitochondrion	IBA	biological process
GO:0005776	autophagosome	IBA	cellular component
GO:0000407	phagophore assembly site	IBA	cellular component
GO:0034497	protein localization to phagophore assembly site	IBA	biological process
GO:0044805	late nucleophagy	IBA	biological process
GO:0006914	autophagy	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0000045	autophagosome assembly	IDA	biological process
GO:0005776	autophagosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000421	autophagosome membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04140	Autophagy - animal
hsa04137	Mitophagy - animal
hsa04136	Autophagy - other

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray