• Gene id: 285966

Gene Summary

• Gene Symbol: TCAF2   Gene   UCSC   Ensembl
• Aliases: FAM115C, FAM139A, GATD9
• Gene name: TRPM8 channel associated factor 2
• Alternate names: TRPM8 channel-associated factor 2, TRP channel-associated factor 2, family with sequence similarity 115, member C, family with sequence similarity 139, member A, protein FAM115C,
• Gene location: 7q35 (143620973: 143730409)     Exons: 13     NC_000007.14
• OMIM: 616252

Protein Summary

• Protein general information: A6NFQ2  
  • Name: TRPM8 channel associated factor 2 (TRP channel associated factor 2)
  • Length: 919  
  • Mass: 100906
  • Tissue specificity: Isoform 2 is expressed in the prostate and in cancerous prostate samples. {ECO
• Sequence:

  MATIAAAAFEALMDGVTCWDVPRGPIPSELLLIGEAAFPVMVNDKGQVLIAASSYGRGRLVVVSHEGYLSHTGLA
  PFLLNAVSWLCPCPGAPVGVHPSLAPLVNILQDAGLEAQVKPEPGEPLGVYCINAYNDTLTATLIQFVKHGGGLL
  IGGQAWYWASQHGPDKVLSRFPGNKVTSVAGVYFTDTYGDRDRFKVSKKVPKIPLHVRYGEDVRQDQQQLLEGIS
  ELDIRTGGVPSQLLVHGALAFPLGLDASLNCFLAAAHYGRGRVVLAAHECLLCAPKMGPFLLNAVRWLARGQTGK
  VGVNTNLKDLCPLLSEHGLQCSLEPHLNSDLCVYCCKAYSDKEAKQLQEFVAEGGGLLIGGQAWWWASQNPGHCP
  LAGFPGNIILNCFGLSILPQTLKAGCFPVPTPEMRSYHFRKALSQFQAILNHENGNLEKSCLAKLRVDGAAFLQI
  PAEGVPAYISLHRLLRKMLRGSGLPAVSRENPVASDSYEAAVLSLATGLAHSGTDCSQLAQGLGTWTCSSSLYPS
  KHPITVEINGINPGNNDCWVSTGLYLLEGQNAEVSLSEAAASAGLRVQIGCHTDDLTKARKLSRAPVVTHQCWMD
  RTERSVSCLWGGLLYVIVPKGSQLGPVPVTIRGAVPAPYYKLGKTSLEEWKRQMQENLAPWGELATDNIILTVPT
  TNLQALKDPEPVLRLWDEMMQAVARLAAEPFPFRRPERIVADVQISAGWMHSGYPIMCHLESVKEIINEMDMRSR
  GVWGPIHELGHNQQRHGWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHEALSPPERERRIKAHLGKGAPLCDWN
  VWTALETYLQLQEAFGWEPFTQLFAEYQTLSHLPKDNTGRMNLWVKKFSEKVKKNLVPFFEAWGWPIQKEVADSL
  ASLPEWQENPMQVYLRARK

• Structural information:
  • Protein Domains: (542..84-)
    (/note="Peptidase-M60)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01060"-)
  • Interpro: IPR029062  IPR035423  IPR042279  IPR031161  
  • Prosite: PS51723
  • STRING: ENSP00000412724
• Other Databases: GeneCards:  TCAF2  Malacards:  TCAF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010359	regulation of anion channel activity	IBA	biological process
GO:0010360	negative regulation of anion channel activity	IBA	biological process
GO:0044325	ion channel binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0090314	positive regulation of protein targeting to membrane	IBA	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0010360	negative regulation of anion channel activity	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0044325	ion channel binding	IPI	molecular function
GO:0090314	positive regulation of protein targeting to membrane	IMP	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0044325	ion channel binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)