Search Result
| Gene id | 285955 | ||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | SPDYE1 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | Ringo1, SPDYB2L2, SPDYE, WBSCR19 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | speedy/RINGO cell cycle regulator family member E1 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | putative WBSCR19-like protein 6, Speedy E, Williams Beuren syndrome chromosome region 19 protein, speedy homolog E1, speedy protein E1, williams-Beuren syndrome chromosomal region 19 protein, | ||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
7p13 (43997867: 44011039) Exons: 10 NC_000007.14 |
||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene is located at chromosome 7p13 which is close to the Williams Beuren syndrome chromosome region 7q11.23. [provided by RefSeq, Jul 2008] |
||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 617623 | ||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q8NFV5 Name: Speedy protein E1 (Williams Beuren syndrome chromosomal region 19 protein) Length: 336 Mass: 40668 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MQKHYTVAWFLYSAPGVDPSPPCRSLGWKRKREWSDESEEEPEKELAPEPEETWVVETLCGLKMKLKQQRVSPIL LEHHKDFNSQLAPGVDPSPPHRSFCWKRKMEWWDKSEESEEEPRKVLAPEPEEIWVAEMLCGLKMKLKRRRVSLV LPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAMVIAYFSRAGFPSWQYQRLHFFLALYLANDMEEDDEDSK QNIFHFLYGKNRSRIPLLRKRRFQLYRSMNPRARKNRSHIPLVRKRRFQLRRCMNPRARKNRSQIVLFQKRRFHF FCSMSCRAWVSPEELEEIQAYDPEHWVWARDRARLS | ||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: SPDYE1  Malacards: SPDYE1 | ||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||
KEGG pathways
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||