• Gene id: 285855

Gene Summary

• Gene Symbol: RPL7L1   Gene   UCSC   Ensembl
• Aliases: dJ475N16.4
• Gene name: ribosomal protein L7 like 1
• Alternate names: 60S ribosomal protein L7-like 1, large ribosomal subunit protein uL30-like 1,
• Gene location: 6p21.1 (42879615: 42889933)     Exons: 7     NC_000006.12
• OMIM: 612887

Protein Summary

• Protein general information: Q6DKI1  
  • Name: 60S ribosomal protein L7 like 1 (Large ribosomal subunit protein uL30 like 1)
  • Length: 255  
  • Mass: 29669
• Sequence:

  MISSCTTRKMAEQEQRKIPLVPENLLKKRKAYQALKATQAKQALLAKKEQKKGKGLRFKRLESFLHDSWRQKRDK
  VRLRRLEVKPHALELPDKHSLAFVVRIERIDGVSLLVQRTIARLRLKKIFSGVFVKVTPQNLKMLRIVEPYVTWG
  FPNLKSVRELILKRGQAKVKNKTIPLTDNTVIEEHLGKFGVICLEDLIHEIAFPGKHFQEISWFLCPFHLSVARH
  ATKNRVGFLKEMGTPGYRGERINQLIRQLN

• Structural information:
  • Interpro: IPR036919  IPR023106  IPR018038  IPR016082  IPR012988   IPR039699  IPR005998  IPR035808  
  • Prosite: PS00634
  • CDD: cd01657
  • STRING: ENSP00000418221
• Other Databases: GeneCards:  RPL7L1  Malacards:  RPL7L1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022625	cytosolic large ribosomal subunit	IBA	cellular component
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IBA	biological process
GO:0003723	RNA binding	IBA	molecular function
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0022625	cytosolic large ribosomal subunit	IEA	cellular component
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IEA	biological process
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0001825	blastocyst formation	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0022625	cytosolic large ribosomal subunit	IBA	cellular component
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IBA	biological process
GO:0003723	RNA binding	IBA	molecular function
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0022625	cytosolic large ribosomal subunit	IEA	cellular component
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IEA	biological process
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0001825	blastocyst formation	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq