• Gene id: 285598

Gene Summary

• Gene Symbol: ARL10   Gene   UCSC   Ensembl
• Aliases: ARL10A
• Gene name: ADP ribosylation factor like GTPase 10
• Alternate names: ADP-ribosylation factor-like protein 10, ADP-ribosylation factor-like 10A, ADP-ribosylation factor-like membrane-associated protein,
• Gene location: 5q35.2 (176365467: 176415095)     Exons: 6     NC_000005.10
• OMIM: 0

Protein Summary

• Protein general information: Q8N8L6  
  • Name: ADP ribosylation factor like protein 10
  • Length: 244  
  • Mass: 27459
• Sequence:

  MAPRPLGPLVLALGGAAAVLGSVLFILWKTYFGRGRERRWDRGEAWWGAEAARLPEWDEWDPEDEEDEEPALEEL
  EQREVLVLGLDGAGKSTFLRVLSGKPPLEGHIPTWGFNSVRLPTKDFEVDLLEIGGSQNLRFYWKEFVSEVDVLV
  FVVDSADRLRLPWARQELHKLLDKDPDLPVVVVANKQDLSEAMSMGELQRELGLQAIDNQREVFLLAASIAPAGP
  TFEEPGTVHIWKLLLELLS

• Structural information:
  • Interpro: IPR042951  IPR027417  IPR006689  
  • Prosite: PS51417
  • STRING: ENSP00000308496
• Other Databases: GeneCards:  ARL10  Malacards:  ARL10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male factor infertility	MIK: 29961538
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R