Search Result
| Gene id | 285525 | ||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||
| Gene Symbol | YIPF7 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||
| Aliases | FinGER9 | ||||||||||||||||||||||||||||||||
| Gene name | Yip1 domain family member 7 | ||||||||||||||||||||||||||||||||
| Alternate names | protein YIPF7, YIP1 family member 7, five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 9, | ||||||||||||||||||||||||||||||||
| Gene location |
4p12 (44656867: 44619577) Exons: 7 NC_000004.12 |
||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||
| Protein general information | Q8N8F6 Name: Protein YIPF7 (Five pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 9) (YIP1 family member 7) Length: 280 Mass: 30632 | ||||||||||||||||||||||||||||||||
| Sequence |
MDLLKISHTKLHLLEDLSIKNKQRMSNLAQFDSDFYQSNFTIDNQEQSGNDSNAYGNLYGSRKQQAGEQPQPASF VPSEMLMSSGYAGQFFQPASNSDYYSQSPYIDSFDEEPPLLEELGIHFDHIWQKTLTVLNPMKPVDGSIMNETDL TGPILFCVALGATLLLAGKVQFGYVYGMSAIGCLVIHALLNLMSSSGVSYGCVASVLGYCLLPMVILSGCAMFFS LQGIFGIMSSLVIIGWCSLSASKIFIAALHMEGQQLLVAYPCAILYGLFALLTIF | ||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: YIPF7  Malacards: YIPF7 | ||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||