• Gene id: 28511

Gene Summary

• Gene Symbol: NKIRAS2   Gene   UCSC   Ensembl
• Aliases: KBRAS2, kappaB-Ras2
• Gene name: NFKB inhibitor interacting Ras like 2
• Alternate names: NF-kappa-B inhibitor-interacting Ras-like protein 2, I-kappa-B-interacting Ras-like protein 2, NFKB inhibitor interacting Ras-like protein 2, kappa B-Ras protein 2,
• Gene location: 17q21.2 (42017575: 42025640)     Exons: 9     NC_000017.11
• OMIM: 604497

Protein Summary

• Protein general information: Q9NYR9  
  • Name: NF kappa B inhibitor interacting Ras like protein 2 (I kappa B interacting Ras like protein 2) (Kappa B Ras protein 2) (KappaB Ras2)
  • Length: 191  
  • Mass: 21508
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAELPRHC
  FSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVS
  VADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG

• Structural information:
  • Interpro: IPR042227  IPR027417  IPR005225  IPR001806  
  • Prosite: PS51419
  • STRING: ENSP00000303580
• Other Databases: GeneCards:  NKIRAS2  Malacards:  NKIRAS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007249	I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0003924	GTPase activity	NAS	molecular function
GO:0007249	I-kappaB kinase/NF-kappaB signaling	NAS	biological process
GO:0005575	cellular_component	ND	cellular component

Diseases

Associated diseases	References
Male factor infertility	MIK: 29961538
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray