• Gene id: 285016

Gene Summary

• Gene Symbol: ALKAL2   Gene   UCSC   Ensembl
• Aliases: AUGA, FAM150B, PRO1097, RGPG542
• Gene name: ALK and LTK ligand 2
• Alternate names: ALK and LTK ligand 2, AUG-alpha, augmentor alpha, augmentor-beta, family with sequence similarity 150 member B, protein FAM150B,
• Gene location: 2p25.3 (288871: 279557)     Exons: 7     NC_000002.12
• OMIM: 0

Protein Summary

• Protein general information: Q6UX46  
  • Name: ALK and LTK ligand 2 (Augmentor alpha) (AUG alpha) (Protein FAM150B)
  • Length: 152  
  • Mass: 16915
  • Tissue specificity: Widely expressed with highest levels in adrenal gland and modest levels in pancreas, testis and uterus. {ECO
• Sequence:

  MRGPGHPLLLGLLLVLGAAGRGRGGAEPREPADGQALLRLVVELVQELRKHHSAEHKGLQLLGRDCALGRAEAAG
  LGPSPEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPVCMED
  KQ

• Structural information:
  • Interpro: IPR029364  
  • STRING: ENSP00000384604
• Other Databases: GeneCards:  ALKAL2  Malacards:  ALKAL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030298	receptor signaling protein tyrosine kinase activator activity	IBA	molecular function
GO:0030971	receptor tyrosine kinase binding	IBA	molecular function
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0070378	positive regulation of ERK5 cascade	IBA	biological process
GO:0030298	receptor signaling protein tyrosine kinase activator activity	IDA	molecular function
GO:0030971	receptor tyrosine kinase binding	IDA	molecular function
GO:0070378	positive regulation of ERK5 cascade	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0010976	positive regulation of neuron projection development	IDA	biological process
GO:0030298	receptor signaling protein tyrosine kinase activator activity	IEA	molecular function
GO:0030971	receptor tyrosine kinase binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0061098	positive regulation of protein tyrosine kinase activity	IEA	biological process
GO:0061098	positive regulation of protein tyrosine kinase activity	IEA	biological process
GO:0061098	positive regulation of protein tyrosine kinase activity	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)