• Gene id: 284996

Gene Summary

• Gene Symbol: RNF149   Gene   UCSC   Ensembl
• Aliases: DNAPTP2
• Gene name: ring finger protein 149
• Alternate names: E3 ubiquitin-protein ligase RNF149, DNA polymerase-transactivated protein 2, RING-type E3 ubiquitin transferase RNF149,
• Gene location: 2q11.2 (101308700: 101271212)     Exons: 12     NC_000002.12

Protein Summary

• Protein general information: Q8NC42  
  • Name: E3 ubiquitin protein ligase RNF149 (EC 2.3.2.27) (DNA polymerase transactivated protein 2) (RING finger protein 149) (RING type E3 ubiquitin transferase RNF149)
  • Length: 400  
  • Mass: 43165
• Sequence:

  MAWRRREASVGARGVLALALLALALCVPGARGRALEWFSAVVNIEYVDPQTNLTVWSVSESGRFGDSSPKEGAHG
  LVGVPWAPGGDLEGCAPDTRFFVPEPGGRGAAPWVALVARGGCTFKDKVLVAARRNASAVVLYNEERYGNITLPM
  SHAGTGNIVVIMISYPKGREILELVQKGIPVTMTIGVGTRHVQEFISGQSVVFVAIAFITMMIISLAWLIFYYIQ
  RFLYTGSQIGSQSHRKETKKVIGQLLLHTVKHGEKGIDVDAENCAVCIENFKVKDIIRILPCKHIFHRICIDPWL
  LDHRTCPMCKLDVIKALGYWGEPGDVQEMPAPESPPGRDPAANLSLALPDDDGSDDSSPPSASPAESEPQCDPSF
  KGDAGENTALLEAGRSDSRHGGPIS

• Structural information:
  • Protein Domains: (67..17-)
    (/note="PA"-)
  • Interpro: IPR042712  IPR001841  IPR013083  
  • Prosite: PS50089
  • CDD: cd16804
  • STRING: ENSP00000295317
• Other Databases: GeneCards:  RNF149  Malacards:  RNF149

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0035690	cellular response to drug	IEA	biological process
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0031647	regulation of protein stability	IEA	biological process
GO:0043409	negative regulation of MAPK cascade	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881